SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001366 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001366
Domain Number 1 Region: 1238-1465
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-39
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 284-396
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-29
Family Cadherin 0.00057
Further Details:      
 
Domain Number 3 Region: 700-812
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-27
Family Cadherin 0.00074
Further Details:      
 
Domain Number 4 Region: 389-494
Classification Level Classification E-value
Superfamily Cadherin-like 1.27e-26
Family Cadherin 0.00073
Further Details:      
 
Domain Number 5 Region: 70-175
Classification Level Classification E-value
Superfamily Cadherin-like 9.99e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 805-907
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.00083
Further Details:      
 
Domain Number 7 Region: 591-698
Classification Level Classification E-value
Superfamily Cadherin-like 2e-24
Family Cadherin 0.0015
Further Details:      
 
Domain Number 8 Region: 177-282
Classification Level Classification E-value
Superfamily Cadherin-like 1.03e-23
Family Cadherin 0.0007
Further Details:      
 
Domain Number 9 Region: 1488-1678
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.05e-23
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 10 Region: 494-595
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-22
Family Cadherin 0.00097
Further Details:      
 
Domain Number 11 Region: 2270-2531
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000000137
Family Rhodopsin-like 0.025
Further Details:      
 
Domain Number 12 Region: 1178-1219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 13 Region: 907-1010
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000137
Family Cadherin 0.0075
Further Details:      
 
Domain Number 14 Region: 1819-1859
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000536
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000001366
Domain Number - Region: 1690-1723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000136
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 1730-1765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000383
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1157-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00207
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 1869-1920
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0034
Family Hormone receptor domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001366   Gene: ENSGMOG00000001265   Transcript: ENSGMOT00000001415
Sequence length 2768
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4123:66:121725:-1 gene:ENSGMOG00000001265 transcript:ENSGMOT00000001415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCRAPREQSAQVGLRCLLQTHLNARGRLSVRLVLRVVSAPVPVGEHGYLSLESDREMYND
QTTRGRRSVNNAPTFKMPNYQLSLAENQEAGTSVITPRATDPDEGEAGRLEYVMESMFDS
RSNDQFTIDPRSGTISTLRPLDREVKDTHVFKVTALDHGTPRRSATTYVTVTVSDTNDHS
PVFEQTEYRDSIRENVEVGFEVMTIRATDGDASANANMVYKILNADDNPAFEIDARNGLV
RVRERPDREARDRYTLIVEANDQXXXXXXRSATATVHIAVDDENDNYPQFAEKRYVVRVR
EDVAVNTKVIRVEATDRDQGNNAKVHYSIISGNVKGQFYIHAPTGVIDIINPLDFESIRE
YNLRIKAQDGGRPPLINGTGMVVVQVVDVNDNAPMFVSTPFQASVLENVAVGYSLLHVQA
IDADSGENARLEYRLADTPPGFPLAINNSTGWVTACGELDRESTEFYKFRVEARDHGVPA
MSSAASVSVTVLDVNDNTPAFTERRYELKINEDAVVGTSVLTLTAVDRDVNSVVTYQISS
GNTRNRFAITSQSGGGLVTLALPLDYQQERQYVLTVTASDGTRADTASVSINVTDANTHR
PVFQSASYQVFLSEDLAVGYVVMVIAASDEDTGENARITYLMEEKVPQFAVHPDTGAITT
QMAVDYEDLSSYTLAIVARDNGIPQKMDTAYVEIIVVDANDNAPLFPRDVYQGSVFEDAP
VYTSVLQISAMDKDSGSNGRLSYTFAGGDDGDGDFFIEPYSGIIRSARKLDRENVPSYSL
RAFAVDKGVPPLRAAVAVHVAVLDINDNAPVFDRDVLVVRVEENRPVGSVVARIGATDPD
EGTNAQIMYQIVEGNSPEFFTLDIFNGDLTALVELDYESRREYVIVVQATSAPLVSRATV
HVQLVDVNDNVPVLQDFEIIFNNYITNKSNSFPSGVIGAVPARDPDVDDELRFRFESGNE
LNLLDLNNRTGELRLSKDLDNDRPLEAAMTISVSDGLHKVVAVCTLRVAIITDDMLTNSI
TVRLENMSQERFLSRLLTLFLEGVAAVLSTNRDAVFVFNIQNDTDVHGSILNVTFSALQP
GGAPGGGRYFPSEDLQEHIYLNRTLLRHISSQQVLPFDDNICLREPCENYMKCVSVLKFD
SSPPFISSDTVLFRPIHPINGLRCRCPAGFTGDYCETEIDLCYSSPCRNNARCHSREGGY
TCECPEDFTGDHCEVNVNSGRCVPGVCKNGGECANRLMGGVMCHCPSGEYEKPYCEMTTR
SFPGQSFITFRGLRQRFHFTVSFRFATRERNALLLYNGRFNEKHDFIAVEIVNEQIQLTF
SGGETKTTVSPFLHGGVSDGQWHSVQLHYYNKPNIGRLGIPHGPSGEKVAVVAVDDCDIA
MAIRFGNQIGNYSCAAQGTQTGQKKSLDLTGPLLLGGVPNLPEDFPVLNRDFVGCMGNLT
VDSKPTDMASFIANNGTNAGCPAKKNFCSREVCQNGGECVNLWNTHGCTCPTGYGGKNCE
QVMPAPQFYDGEALVSWSEPDVTIAVPWYLGLMFRTRQPGGTLMQANAGRSSTINLMVSG
QQVRLEVWFQDELVASLAFAQVRVSDGEWHHLLVELSSFKDGQDIKYMASVSLDYGMYQQ
RSVEIGNELPGLKVKTLFVGGLLGEGNHVTQGFTGCIQGVRMGETSTNVLNVNMAQGLKI
RVEEGCDLADPCDSNICPENSHCSDDWSTHTCVCDLGYFGKECLDPCQLNPCEHVSTCVR
KPSSSHGYTCECGTSYYGQYCQNKVEKPCARGWWGSPMCGPCDCDTTRGFNPNCNKTTGE
CRCKDNYYRPVDEDSCYPCDCFPIGSESRTCDPRTGQCPCKGGVIGRQCNRCDNPFAEVT
AAGCQVVYEGCPKAFDAGIWWPKTQFGRPAAINCPKGSIGTAVRHCNDEKGWLPPELFNC
TTTSFSSLKKMNEELRRNESVMDGARSKAIVRLLHGATNNTQRYYGNDIKTGNELLVRVL
QYESRQAGFDLTATRDADFNENLVRAGSALLDPGTKEHWEHWEQIQRGEGGVALLLHSFQ
DYAGTLAQNVRKTYLKPFTIVTDNMILTVDYLDTSDPDRTTFPRFQDIQEAYSPELGSSI
NFPEFNPHSPVPRTQTDAPEGEEPTAANRKRRHAEPAAHLPVAVVIVYKSIGQLLPERYD
PDRRSLRIPNRPVINSAIVSATLHSEGLPLPLPLEPPVTVRLRLLETEERTKPVCVFWNH
SLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGEVLPLRIVTYTTV
SVSLLLLLLTFLLLCLLHRLRSNLTAIHRNLVAALFFSLLVFLLGINQTDNPFVCTVIAI
LLHYFYMCTFAWMFVEGLHIYRMLTEVRNINHGHMRFYYAIGWGFPAIITGLAVGLDPQG
YGNPDFCWLSVHDTLIWSFAGPISLVVLVNIVIFVFAAKASCGRRQKAMEKSGAIPALRM
AFLLLLLISATWLLGLLAVNSDVMTFHYMFAVFSCLQGVFIFFFYVIFNREVRKNLKSVF
TGKKSLDETSTTKASLLTRSLNCSNTYGEDGGVFRSGLGESSVSLDSTLREEVKAGVSSG
LVKGHTDLDGPLFHRNPNNRADSDSDSELSLDEHSSSYASSHSSDSEDDGHQAKPQWNNE
RQPVHSTPKVDAVANHVRPYWPVDGTTASDSEEPCGAGEGLRVETRVNVEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILKNKISYPPPLSDKNMKN
RLREKLSD
Download sequence
Identical sequences ENSGMOP00000001366 ENSGMOP00000001366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]