SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001612 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001612
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.05e-28
Family Hormone receptor domain 0.0000501
Further Details:      
 
Domain Number 2 Region: 77-377
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000439
Family Rhodopsin-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001612   Gene: ENSGMOG00000001536   Transcript: ENSGMOT00000001670
Sequence length 428
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2080:16156:31860:1 gene:ENSGMOG00000001536 transcript:ENSGMOT00000001670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVSYSGHCIIKREHEKCMEQIEQHTPNDDLEFGCPWLWDNLTCWQAAGVGQVVEVNCPEL
FNEFMNPHEGMGKVVRNCTEDGWSEPFPHYVDVCLFDDMYYASVKALYTVGYSTSLVSLT
TAMVILCRFRKLHCTRNFIHMNLFVSFILRAISVFIKDGVLYAEEEDSDHCFEHTXXXXR
CRVVMVFFHYCVMSNYFWLFIEGLYLFTLLVETFFPERRYFYWYTIVGWGTPTICVAVWA
VLRLHFDDTGCWDTNENTALWWVIKGPVVASIMINFVLFVGIIIILVQKLQSPDIGGNES
SIYLRLARSTLLLIPLFGIHYTVFAFSPEDVSKRERLVFELGLGSFQGFVVAVLYCFLNG
EVQSEIKRKWRSWTVNRYFAVDLKQQRHPSLASSGVNGGTQLSILSKSSSQIRMSSPLAE
NANLSLPT
Download sequence
Identical sequences ENSGMOP00000001612 ENSGMOP00000001612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]