SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001852 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001852
Domain Number 1 Region: 3-379
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.29e-81
Family Formin homology 2 domain (FH2 domain) 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001852   Gene: ENSGMOG00000001656   Transcript: ENSGMOT00000001914
Sequence length 423
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2296:405816:412590:-1 gene:ENSGMOG00000001656 transcript:ENSGMOT00000001914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LKPFHWDALPKASVEGKHNIWTAERPRGEYKLDTDRMEELFSHDSPGLGSMKTKTLHRMS
VKPSSAGRGEAVTILSQKRSMNVGIFLKQFRRPVRDMIADISSGTSTGFGTGKLRELCKM
LPEEGEVRDLKKFKGKEAALAEADLFMLMLVKTPSYEERLNCLVLQEEFFPIMEDMKRSI
TLLTAAAKELLECENLHSVILLVRKTGNHLNAGSYAGSAIGFRMSSLLKLVDTKANKPGM
NLMHYVVMEADKYDSNLLQFPQQLKLIGAASRINKDDISAEFQKEVKRVQVAKVEAEKQE
NLKALMDDFLKGAASLVTEMQQSLEALNAASDSVAQFFGEDPSKFKLQECCTIFSTFCEK
FMRAIQENKDRIASEIKKKNRLHIAAKRRSTATCAWEKESKGMELESFLHTFASSRSSRR
RIG
Download sequence
Identical sequences ENSGMOP00000001852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]