SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000001962 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000001962
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0000000000206
Family Polyphosphate kinase C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000001962   Gene: ENSGMOG00000001849   Transcript: ENSGMOT00000002025
Sequence length 135
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_259:502948:504081:-1 gene:ENSGMOG00000001849 transcript:ENSGMOT00000002025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HDACSCYFPTHSDVPAPCLDLGWPERSIARPGCVKVLTNPPEEGQPSIREIVRRHLQQAS
QVIAIATDRLTDNVVIGDLHSAASRGVPVYIILNQRSTQEDCTPSMLRHPNMQVRVLGGK
TFCSREGRMVVGQMK
Download sequence
Identical sequences ENSGMOP00000001962 ENSGMOP00000001962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]