SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002192 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002192
Domain Number 1 Region: 68-170
Classification Level Classification E-value
Superfamily TPR-like 1.86e-22
Family Tetratricopeptide repeat (TPR) 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002192
Domain Number - Region: 193-250
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0199
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002192   Gene: ENSGMOG00000002050   Transcript: ENSGMOT00000002262
Sequence length 294
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1544:112277:116681:-1 gene:ENSGMOG00000002050 transcript:ENSGMOT00000002262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQKISDLKAFVQLCQSNSSVLHLPEMEFFRTWLKIDNEGVIEPDTDEPQEMGDFENLE
VTEEMMEQANDKKMEAINALGEGDLPKALELFTDAIKLNPCVAILYAKRASVFIQMKKPN
AAKRDCDRAITINPDSAQPYKWRGKANKLLGNWEEAAKDLATACKLDYDEDASALLKEVQ
PKATKIIEHRRKYERKREEKEIKDKKERIKKAKEEHERAQKAGGFPGGAPFGMPGIGDLL
NDPEVLNAMKDQDVMDAFQDVAQNPANISKYQGNPKIMALITKLSAKFGAPPQT
Download sequence
Identical sequences ENSGMOP00000002192 ENSGMOP00000002192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]