SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000002947 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000002947
Domain Number 1 Region: 345-401
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000667
Family TSP-1 type 1 repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 459-508
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 3 Region: 293-342
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000124
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 4 Region: 211-258
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000115
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 5 Region: 404-457
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000002947
Domain Number - Region: 892-1157
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000101
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number - Region: 515-581
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000719
Family Hormone receptor domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000002947   Gene: ENSGMOG00000002756   Transcript: ENSGMOT00000003040
Sequence length 1536
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_948:610266:630060:1 gene:ENSGMOG00000002756 transcript:ENSGMOT00000003040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPASATCATLEQSRFFGVFTSAAALPSTPCSWTLQNPDPRRYTVYMKITKPTDACTPRQI
RTFQFDSFIETSRTYLGMESFDEVVRMCDASTTVTYLESTKQFLQVRKVAPRNALQEMVE
EVGGDGEFKAEFLVVGKRNPSMPACQMLCLWLEKCLAASSHDNPCGIMNTPCQCWETPQR
KPGSCFRGGVYVEKCTTVPKDATRDAEIIKGWSTWGRWAECSQECGGGVQVRNRACQPEN
SVCQGVVEEGRACNPQPCIAGKARGMSQGLRSIIGLKRDNVDDSSRAVAAPAVEAVVDEW
SQWSVCSVTCGEGWQGRTRTCVTSIFTTQCTGPLRENRPCNNSAVCPVDGAWDEWAPWSL
CSSTCGRGFRERLRSCKQPEHGGEPCTGPKKQTKYCNIAICPGQDGSWNEWAAWTPCSTS
CSNGTMQRTRECNGPSYGGSECHGGWKESTNCFLKDCPVDGRWQTWTTWASCSKSCGGGV
QQRQRMCEGPLFGGVPCPGVTEEKKRCNERRCPEPHEICPEELTGDVIWKRTPAGDISAV
TCPSDASGLILRRCTLDAVGLAYWESPTHIKCISENYKTIQTMAQEFSSQNHTGQGIDGI
PEVISRLRSSTDQGATYSGDLLATMEILRNTTEMYKGTSLRMSNADKENYIQTISNLLKE
EHRDKWEEAQLMGANVKEFLRLVEDFVNLIGTQMRGFEDVYEVTENLVLSIHKRPTSTAS
NFNFPEKGWRGMLDWVRTAEEKITVSRDALSIDQSFLFSLSFGVDGTTAFFTGIVLYRNL
GAIISQQSNSSLLNSKVVTVTVSPSPNLLSSPIEIEFPHLHNGTINETCISWDESETSAL
CSSSLLGTWSARNCRAVVVDSFRTKCVCDSLSTFALLSRINTDLNMDKALLPSVTLIVGC
GVSSLTLLLLIIIYVSVWKYIRSERSVILINFCISIICSNALILVGQTQARNKVVCSLVA
ALLHFFFLSSFCWVLTEAWQSYMAVTGRLRNRIIRKRFLCLGWGLPALVVAVSVGFTKAK
GYGTVTYCWLSLEGGLLYSFVGPAAAVVLVNMVIGILVFNKLVSKDGITDVKLKERAGAS
LWSSCVVLPLLALTWMSAVLAITDRRSALFQILFAVFDSLEGFIIVMVHCILRREVQEAV
KCRVVDRKDDGNGDSGSSQQNGHSQHVSDFEKDGDSSRQAFQRICNLFPPCDCSIHSTFF
SLIFLIGMTSSSEEKLTPPQMPLPMGPNFHTLPSNPSGKTQMQAMPEYSSHTLTLKREKS
RLAGGVDPSCGKPVYVCDGELFKQLDADMARGHVDCGLCGVSGGYVLMPNTTSTLRTKPK
EDMSKYNMGLDQLPQLPQTRLVHLSGPFAEPQAAFGLQQLPSDQVSVSYSERDSPIQNLH
NMSSESHITHSSLENTFESMNSMMSKSETISTLSMSSLERQKSRYAELDFEKIMHTKKRH
QNMFQDLNRKLHHAEKDRESPASDTKQDKQQAPLDRPWDGGNRGMQQQQQSPPAWVRKDL
EPLAASPLELHSVDWEKVGTTIPLVGQDIIDLQTEV
Download sequence
Identical sequences ENSGMOP00000002947 ENSGMOP00000002947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]