SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003180 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000003180
Domain Number - Region: 484-564
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0523
Family HBL-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003180   Gene: ENSGMOG00000003015   Transcript: ENSGMOT00000003279
Sequence length 676
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2878:132795:145143:1 gene:ENSGMOG00000003015 transcript:ENSGMOT00000003279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQLKFVVEQLNKEPFKKNFNLIMFDSLEPMQLLQNLNDVLAEIDPKQAIDIREEQPEQ
TAKRMFSMLGMLKYKPLGPQADASSFRRGLVTGSKPVIHPLLQWLLQRLPELRKRAYLAR
YLVKLEVPAEFLQDDVISDTFHQYEELVETFKTYHRECEQLKTSGFSTAEIRKDIGVMEE
EKDQLIKRVERLRKRVDTVPNHQRMLDLARQLRVEKEREEALAHQKQEQKNQLFRAEQRL
QVSLQKLKDLRQASVDADPESLMRRLEEEIKINTYIVMEKLPKELESTRRSLHFLQKVAS
EPSLGPAELQEMEDKIKEVSAQINQLTEKRMMRSDPMDDKLTLFRQQASIISRKKEARAE
ELQRAREELAAAERELTQRSSQARGGDGEEMVRGDELKRLVAKLRVKGSTHKKRRAELAE
LKAENGVLERTEEILHQRNQDVLQQLQSMEEQKGISGFSDTQEELERVSAAKSELDDVKG
RTLDDMSEMVKKLNSMIAEKKTALAPIIKELRPLRQECQALTQEYEEKKAQYDSCAAGLE
SNRSKLEQEVKALREETAQEENRYHELNCMKQMAEVQLQRALEETRAYVSSDPQERKKAV
REVYMKSIAEQDTLGKKLREKQKAVRESHGANMKQVKMWRDLEQLLDCKKQCFQRAQIQA
STGQVVEEGAEDWLVL
Download sequence
Identical sequences ENSGMOP00000003180 ENSGMOP00000003180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]