SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003286 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003286
Domain Number 1 Region: 13-289
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-64
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003286
Domain Number - Region: 456-514,549-637
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0497
Family HBL-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003286   Gene: ENSGMOG00000003103   Transcript: ENSGMOT00000003388
Sequence length 741
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1962:48924:65571:-1 gene:ENSGMOG00000003103 transcript:ENSGMOT00000003388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKPPFRQNQSCGAWELKERLGMGGFAHVYLYQHHETNEKLAVKMCRLELTARNKDRWSR
EIQIMKKLNNINVVTAREVPEEMNHIALNDLPLLAMEYCSRGDLRKLLSKPENCCGLKES
EVLSLLNDVGSGIQYLHENKIIHRDLKPENIVLQDVSGKLVHKIIDLGYAKDLDQGSLCT
SFVGTLQYLAPELFETKPYTVTVDYWSFGTMVFECSCGFRPFLHNLQPVQWATKVRNKGP
KDIMAVEELTGEVRFSTHLPYPNNLSSTLLEPMEGLLQLMLKWDPVQRGGRMGADSKKPQ
CFEVLEQILNMKVVHILNMTTAQVHSLELAPEESLHSLQRRIEAETKIEVVNQELLQETG
VSLDPRKPAAQCVLDGVRGWDSYIVYLFDKSLTKYSGPLSARPLPDKVNSIVQEAKTQLP
LGVLKKVWGEAVSYICGLKDDYSRLFQGQRAAMLSLLRYNTNLTRYKNSMFGFSQQLKAK
LDFFKSSIQYDLEKYSDQMHYGISSEKMLKAWQENEERAAAFAQVAEVGHLDEEIMALHS
EIVELQRSPYARRQGDKMEQLEEKAIELYKQMKIKCKTPESEVCSDSSEMVKAIIQTVQN
QDKVLKDLYTHLSKILLSKQKIIDLFPRIEKTLESIKEADNTVMLMQIKRQKEFWHLLKI
ACAQNSSRNSIAASPETSNPLQASQWSQSAQPISSPHPLTSLPGPNDSDAAPRLLQENQR
YLSQLTSLMQDAADEQAKSIV
Download sequence
Identical sequences ENSGMOP00000003286 ENSGMOP00000003286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]