SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003652 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003652
Domain Number 1 Region: 14-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.13e-30
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 2 Region: 127-185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000432
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003652   Gene: ENSGMOG00000003471   Transcript: ENSGMOT00000003762
Sequence length 185
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1396:357989:379170:1 gene:ENSGMOG00000003471 transcript:ENSGMOT00000003762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVFSPLSPGFIHTCGGTLKGRNGTIESPGFPYGYPNGANCTWVIVAEERNRIHIVFQSFA
VEEEYDFLSLYDGHPHPVNFRTRLTGFTIPAPVTSTGSIFSLRLTSDFAVSAHGFKIAYQ
ELRSSACGNPGVPPKGILNGTQFNVGDKIRYRCVTGYVLDGHSLLTCVSNTAGVSVWDFP
VPICR
Download sequence
Identical sequences ENSGMOP00000003652 ENSGMOP00000003652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]