SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000003733 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000003733
Domain Number 1 Region: 21-118
Classification Level Classification E-value
Superfamily Hormone receptor domain 8.11e-28
Family Hormone receptor domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000003733
Domain Number - Region: 120-390
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0311
Family Rhodopsin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000003733   Gene: ENSGMOG00000003519   Transcript: ENSGMOT00000003844
Sequence length 395
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1073:6926:16974:1 gene:ENSGMOG00000003519 transcript:ENSGMOT00000003844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRVMGLGGLGEEEGDPDNTACRPQSHILTAQFECYMKINEDPPRQGNGTFCNRTWDGWL
CWGDAEPGTVLQMCPEYFQDFDPAEKVTKVCNPNGTWFHHPESNRVWSNYTQCAAYTKGK
LKVAYSLFYLALLGHGLSIISLLISLIIFSYFKSLSCQRVSLHKNMFMSFILNSVVTVIW
LSTVPNNQELVASNPISCKVLSVVIQYTFASSYFWMLCQGIYLHTLIIVAVFVGEQQLVS
YYILGWGFPVIPAITYAVGRGMFYNDNCWISSNTRLLYIIHGPIHVALLVNLFFLLNIVR
VLITKLRVTHSAETTAYMKVVRAILILIPLLGVQFILVPCRPTGRLAFAVYEFTMNIFSH
FQGLLVAIIFCFCNSEAQTALRRKWAQWKIVWEKN
Download sequence
Identical sequences ENSGMOP00000003733 ENSGMOP00000003733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]