SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004250 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004250
Domain Number 1 Region: 16-108
Classification Level Classification E-value
Superfamily EF-hand 6.16e-22
Family Parvalbumin 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004250   Gene: ENSGMOG00000003990   Transcript: ENSGMOT00000004381
Sequence length 109
Comment pep:known genescaffold:gadMor1:GeneScaffold_1790:306926:308505:1 gene:ENSGMOG00000003990 transcript:ENSGMOT00000004381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAITDFLAASDITSAISACKAKDSFSAKMFFKTVGLSKKTAAEVEKVFKILDQDKSGFIE
QDELQLFLQNFSKGARNLTAAETRAFLLAGDSDGDGKIGWEEFSALVKS
Download sequence
Identical sequences ENSGMOP00000004250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]