SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004379 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000004379
Domain Number - Region: 181-209
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.00851
Family Cytochrome c3-like 0.072
Further Details:      
 
Domain Number - Region: 25-113
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0968
Family HBL-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004379   Gene: ENSGMOG00000004145   Transcript: ENSGMOT00000004512
Sequence length 224
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3776:24789:34149:1 gene:ENSGMOG00000004145 transcript:ENSGMOT00000004512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEQEIMCKLENILEIRNKTIQMQKIKSRLKTEFDSLESEEKHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMESTIKQSENDLNKLLETTRRLHDEYKPLKEHVDALRMTLGLHRL
PNLNEEEEKLSLDYFEKQKAEWQKEPHEPAIPESLAAAAAAAQQLQVSRKQDARQTATFR
QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKPDE
Download sequence
Identical sequences ENSGMOP00000004379 ENSGMOP00000004379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]