SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004714 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004714
Domain Number 1 Region: 4-204
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-44
Family DBL homology domain (DH-domain) 0.00047
Further Details:      
 
Domain Number 2 Region: 667-736
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-17
Family BCR-homology GTPase activation domain (BH-domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 562-623
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.0000000000000589
Family BCR-homology GTPase activation domain (BH-domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 218-280
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000358
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004714   Gene: ENSGMOG00000004425   Transcript: ENSGMOT00000004854
Sequence length 783
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3714:2751:23524:-1 gene:ENSGMOG00000004425 transcript:ENSGMOT00000004854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AECDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTVAQIETIF
FKVPELYEIHKEFYDSLLPRVQQWSHHQRVGDLFQKQASQLGVYRAFVDNYELAVETAEK
CGQANTQFAEISENLKVRSNKECKDQSAKNSLETLLYKPVDRVTRSTLVLHDLLKHTPAS
HPDHPLLQDALRISQNFLSSINEESTPRRQSMTVKKGENRQLLKDGFMVELVEGARKLRH
VFLFTDLLLCAKLKKQLGGKSQQYDSKWYIPLSELSFQGPEESEPLTIPQVPDEELDAMK
VKISHLRSEIQREKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSYIFLI
SSDYERAEWKEMIKEQQKKCLKSFSLTSLELQMLTNSCVKLQTVHSIPLTINKEXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEVK
LSMKFTSREFSLKRMPSRRPMGVFGVKISTVTKRERSKVPYIVRQCLEEIERRGMEEVGI
YRVSGVATDIQNLKAAFDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLSDSVAKESCMLNLLLSLPEPNLVTFLFLLDHLKRVAEKECVNKMSLHNLATVFG
PTLLRPSEKDSKIPTNPTQPISMGDSWSLEVMSQVQVLLYFLQLETIPTPDSKRQSILFS
TEV
Download sequence
Identical sequences ENSGMOP00000004714 ENSGMOP00000004714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]