SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000004853 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000004853
Domain Number 1 Region: 637-1035
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.92e-87
Family Formin homology 2 domain (FH2 domain) 0.0000749
Further Details:      
 
Domain Number 2 Region: 66-291
Classification Level Classification E-value
Superfamily ARM repeat 7.33e-27
Family Diap1 N-terninal region-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000004853   Gene: ENSGMOG00000004528   Transcript: ENSGMOT00000004994
Sequence length 1171
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_467:54027:84253:-1 gene:ENSGMOG00000004528 transcript:ENSGMOT00000004994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEDSTLQVSSRGNYVDLECSLAEQRDDLGNFYQDIXXXXXXXXXXXXXXXXXXXXXXXKL
YNSQGPELRRALFSLKQLFQDDEDLVPEFVVSEGLTCFIKVGAEADHNYQNYILRALSQI
MLFVDGMNGVIGHNQTVQWLYTLTGSLSRLVVKTALKLLIVFVEYNESNSPLLITAVNTV
DNKRVDVEPFRYVMDILEEKNGFDNELLIYTMTLLNKTVAALPDQDSFYDVTDSLERLGM
ERVMQKHTSNKSLEPELRQQFSIYEAALRYEDGDVEDLSPQLRKERRKVSSDQEGRRSRR
TSAQNLPDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRG
TSGVLLHLPGGGGPPPPPPLPGLGAPPPPPLPGLGGPPPPPPPPPAPSSSKRKTVKLFWK
ELKQAEGLDRGLKCKFGRGTVWASLDKVVVDSAKLEHLFESKAKELTVAKKGVEVKKSEI
LVLDPKRSNALNIGMKVLPAVHIIKAAILAFDEFAISKEGIEKILTMIPTEEEKVRIQEA
QLANPDVPLGSAEQFLLTLASINALAPRLQLWSFKLNYEATEKDIAEPLFDLKLGMDQLS
KNETFRRILAALLAIGNFLNSSNAPGFELSYLEKVSEVKDTVQRQTLLHHVCCQILDTYP
ESTDVYSEIPAITRSAKVDFEQLADSLVLLERKCKASEENLKLVSKHETKAVLRNKMSVF
LKDCSHRIGILKVVHRRVINRFHSFLLFLGQPSHGVRDVAVTRFCGVLSEFSLEYRTTRE
RLLTQRRKRAAHRERTKTRGMMITETEKFSGAVPSQEENEDGVVGQEQGEKEHDHMTNLL
MTSHPQTLRRSRGQGRASPSQSPVSKDDIITGGQDDATDEIMDQLVKSVTQKPSERPASP
KTRKRSRLNRKSLRRTLKTGLSVDVVQALGL
Download sequence
Identical sequences ENSGMOP00000004853 ENSGMOP00000004853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]