SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005174 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005174
Domain Number 1 Region: 5-91
Classification Level Classification E-value
Superfamily PDZ domain-like 3.55e-26
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 2 Region: 159-240
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-23
Family PDZ domain 0.00041
Further Details:      
 
Domain Number 3 Region: 99-108
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000222
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005174   Gene: ENSGMOG00000004891   Transcript: ENSGMOT00000005328
Sequence length 354
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4495:21881:47418:-1 gene:ENSGMOG00000004891 transcript:ENSGMOT00000005328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDEKPRLCCMTKGENGYGFHLHGEKGKSGQYIRKVEAGTAAEVSGLRAGDRVIQVNGE
NVEKETHHKVVQRIKALEGETRLLVVDRRTDELLRRCPPPPPPPPPPPPSSPPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELVPRMCVLARSEAGYGFNLHSERA
RPGQYIRSLDAGSPAEHAGLRPQDRLIEVNGVNIEGMRHAEVVAFIKNGGEGTRLLVVDP
DTDEHFKTKGVVPTVDHLRDYDGPSISNGSRSPHLNGKFTTHSIRSTQSNQSSQADSTQM
ADDEGSRLLDAFAEIGLRLSPTAAEEKEKARANRSKKRAPQMDWTMKYKLFSNF
Download sequence
Identical sequences ENSGMOP00000005174 ENSGMOP00000005174

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]