SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005609 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005609
Domain Number 1 Region: 219-358
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.29e-33
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.035
Further Details:      
 
Domain Number 2 Region: 69-151
Classification Level Classification E-value
Superfamily WWE domain 3.79e-18
Family WWE domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005609   Gene: ENSGMOG00000004950   Transcript: ENSGMOT00000005775
Sequence length 365
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4572:2130:7030:-1 gene:ENSGMOG00000004950 transcript:ENSGMOT00000005775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CFGAHYKLPYSWEVLKGHQWTLLDSSKEIEEDYCNPKITYSTVDVEVVCFDTMTRGLQKV
RRLSSISSVLQPTSILTTEWLWYWEDEHGNWNQYDSPPNSSTELEQKFQNNPQEVVEFTA
GSQTYTLSLQDMIQTNKAYGTKRVVRRRPRFLSSVDVQVIRTRCVPPGGRTASLFAFREV
KRLGPATKHYGHKKKVAVYFFISVKGLQMVHQMSKLFPNAGTRQRKQMKTRNGGHSVAER
KLFHGTDSKFIDPICCSNFDWRICGTHGTTFGKGSYFARDASYSHKYTGNTSTVRSMFVS
RVLVGHHTRGEAAYVRPPSKDGGDTLFYDSCVDNIRSPSIFVVFDRPQIYPEFLLTYQAK
AAVVG
Download sequence
Identical sequences ENSGMOP00000005609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]