SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005610 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005610
Domain Number 1 Region: 101-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.93e-25
Family Canonical RBD 0.000015
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000005610
Domain Number - Region: 31-39
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005610   Gene: ENSGMOG00000005278   Transcript: ENSGMOT00000005776
Sequence length 373
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3789:270085:289911:-1 gene:ENSGMOG00000005278 transcript:ENSGMOT00000005776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGLYYPSLLSGSQDTTGGQEGLVPPFSAFPPPPPPPPPQNGLALEYGASLYAAGAVVQG
PVEAGGPGGPPGGSLVPQIDGQSSAGSGGGGGGGGSVADDDAKGTPKRLHVSNIPFRFRD
PDLRQMFGQYGKILDVEIIFNERGSKGFGFVTFETSVDAERAREKLHGTLVEGRKIEVNN
ATARVMTNKKISTPYSNAGWKLSPMVGAMYSPELYTGLNATVLHLFLFXXXXXXXXXXXX
XXXXXXXXXXXXXXTAATFRGAHLRGRGRPVYSAVRAAVPQQAIPAYPGXXXXXXXXXXX
XXXGGYAAYRYAQPTAVAAPSAAAAAAAAAAYSDSYGRVYTADPYHAALAPAAYGVGAMA
TLYRGGYSRFAPY
Download sequence
Identical sequences ENSGMOP00000005610 ENSGMOP00000005610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]