SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005709 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005709
Domain Number 1 Region: 629-984
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 9.68e-96
Family Formin homology 2 domain (FH2 domain) 0.0000391
Further Details:      
 
Domain Number 2 Region: 51-179,238-435
Classification Level Classification E-value
Superfamily ARM repeat 4.68e-85
Family Diap1 N-terninal region-like 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005709   Gene: ENSGMOG00000005334   Transcript: ENSGMOT00000005877
Sequence length 1067
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1876:1548611:1566737:-1 gene:ENSGMOG00000005334 transcript:ENSGMOT00000005877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNVAAGALEQDRGEGRDVRSPGGRGMSDPTPSPKKKKAPLKLPMPPEDELDERFNMVLS
SINLPPDKLKLLSQYDNEKKWELVCDQERFQVKSPPSIYLTKIKGFYQDQGGVPRKVGKS
KKSIQEATKVLKDLEISLRTNHIGWAQEFLDEENRGLDILVEYLSYAQSYVFDTVDSVFN
GGPEERAKSMERSLEDLNKSSSSTQSHGMSRAARALTVRISKTLNNRIHKRSPLASQRDD
VHVCIMCLRAIMNYQSGFNQVMSHASCVNEITLGLNSSNPRTKALVLELLAAVCLVRGGH
DIILSAFDNFKEVSREKNRFEKLMEHFSNDDSNLDFMVACMQFINIVVHSVENMNLRVHL
QYEFTHQGLDDYLEKLKKTESEKLQVQIQAYLDNVCDVGALLEDAECRDGGMEHVDELHQ
HNVELSSRLQELEGQATERVAQLEAQLLQSTKETELLKVXXXXXXXRFSTSPPPGPSTSS
ELERKVQELQDKGLIRLERTASGSLDLQVVPVTVTEYVQAPPSQPQADEVDSTSSPPPPP
PLPGGTGSAPPPPPPPPPTGXXXXXPPGPGGCPPPPPPPPPPGVGPPPPPPPPGGGPPPP
PPPPSWPPLQTVCVKSRKAIQTKFRMPLLNWQALKPNQVTGTVFNELDDEQVLDELNMEM
FEEQFKTKAQGAPSDLSTLKVKVAQKAPTKISLMDTNKAKNLAITLRKAGMSPDDVCVAI
DTYNQQALGLDFLELLERFIPSDYEMKLLVNYEKEGREIEALTDEDRFMLRFGRIPRLSQ
RISTLTFMGNFPETVKRLQPQLDSLISASMSIKSSPKLKKMLEIILAFGNYMNSSKRTAA
GGFRLQSLDLLLETKSTDRSQTLLHFITTVILEKYPDLATFHTELHFVDKAALVSMDGIL
QDILALERGMEMTKKEFLVQEDNKVLQDFVKTNSNQLALLVKDGKTAQEAYGSVVEYFGE
NPKNTQPSMFFPTFARFMKAYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPPMD
FMAELKKRQVKPQVREGKDGALEDIITXLRNTPYRDGRRRPAQQPEP
Download sequence
Identical sequences ENSGMOP00000005709 ENSGMOP00000005709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]