SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000005949 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000005949
Domain Number 1 Region: 133-225
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-21
Family Ubiquitin-related 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000005949   Gene: ENSGMOG00000005610   Transcript: ENSGMOT00000006123
Sequence length 266
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1956:88785:99016:-1 gene:ENSGMOG00000005610 transcript:ENSGMOT00000006123 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCVGREREDTQGHGSSRNGGRAHRRRGGRNEPLKKDRPKWKSDYPMTEGQLRSKRDEF
WDTAPAFDGRKEIWDALKAAAVALECSDHELAQAIVDGASITLPHGTLTECYDELGNRYQ
LPVYCLAPPVNLISERSDEDPSDSPEPPVAPKKEFQLKVRMSTGKDLRLSASMADTIGQL
KKQLHAQEDIDATHQRWFFSGKLLTDKTRLQDTKIQKDFVIQVIVNPLASLAHPPSPASA
TTTAITSTISITSSALANTTPATDSN
Download sequence
Identical sequences ENSGMOP00000005949 ENSGMOP00000005949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]