SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006005 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006005
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.38e-22
Family Ubiquitin-related 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006005   Gene: ENSGMOG00000005653   Transcript: ENSGMOT00000006180
Sequence length 160
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2102:224745:227112:1 gene:ENSGMOG00000005653 transcript:ENSGMOT00000006180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGKMILTVKPLQGKECNVQVTEDDKVSTVKELVSERLNIPANQQRLLYKGKALADEHSLS
DYAIGPDAKLNLVVRPVGERTSTAGMAGSSGSSSPQGGVWQTLSTVLAKHFSPADAAKVH
EQLIKDYERSVRQLSLDDIERLAGRLLHPDSEGMDTSYLD
Download sequence
Identical sequences ENSGMOP00000006005 ENSGMOP00000006005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]