SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006086 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006086
Domain Number 1 Region: 20-92
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000744
Family Calmodulin-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006086   Gene: ENSGMOG00000005736   Transcript: ENSGMOT00000006262
Sequence length 123
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3745:20770:23070:1 gene:ENSGMOG00000005736 transcript:ENSGMOT00000006262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHFRPPSIRLDDEQKEVIRTEKLRFLFNMHDTDNDGTITLEEYRHVVEELLSRSGALGK
ETAKGIADAAMLEVASISMGHMEPDEFYEGITFEHFNKLLKEFEVESRMNIRFMNMDTTT
LCK
Download sequence
Identical sequences ENSGMOP00000006086 ENSGMOP00000006086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]