SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006306 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006306
Domain Number 1 Region: 13-66
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000085
Family Hormone receptor domain 0.0038
Further Details:      
 
Domain Number 2 Region: 111-376
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000156
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006306   Gene: ENSGMOG00000005923   Transcript: ENSGMOT00000006487
Sequence length 459
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3054:39737:48541:1 gene:ENSGMOG00000005923 transcript:ENSGMOT00000006487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVEGSVLEGLVAKRTQYLENCIKTLETIPKTGICNGSFDMFVCWPHSPAGKVSVPCPSYL
PWINNGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXADMVPLHSALRV
VSLVGYSLSLCSLSLATLLMALFRKLHCTRNYIHMNLFGSFILRALSVILKELLLHILYN
RTFTDDAGWNSYYNSATAVMCRVARVAMEYFVACNYFWLLVEAIFLHTLLFTAVLTKRRL
LKRYMFLGWVTPVLFVTPWTAIKIQYENRIIFLIFIKILMLLLSKLKADQGKFTDYRYSL
LRATLILFALLGIHEVVFTVLYAESLDGSARYARNFINLTLCSFQGFVVAVLYCFANGEV
QAELKKRWQLFLFTNRFQFRSCLRATPFKHLWKCSRGRGPHHSQQQSESCDEGTTSINPH
LLQVAVHGGGPLVLLSCKRPSSSDVEMTQGETLEEIMEE
Download sequence
Identical sequences ENSGMOP00000006306 ENSGMOP00000006306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]