SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006502 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006502
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily L domain-like 4.93e-24
Family Ngr ectodomain-like 0.0039
Further Details:      
 
Domain Number 2 Region: 199-316
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.0000000000000123
Family Hormone receptor domain 0.0091
Further Details:      
 
Domain Number 3 Region: 134-231
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000631
Family I set domains 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006502   Gene: ENSGMOG00000006114   Transcript: ENSGMOT00000006693
Sequence length 1241
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2102:534603:544092:-1 gene:ENSGMOG00000006114 transcript:ENSGMOT00000006693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLKHNLISTIMPGAFQGLSELRKLDLSNNRICVTADMFQGLSNLTKLNLSGNIISTLDPG
VFQELPSLKLVNFNSDFLSCDCGLRWVPGFFRSSSARLGDETLCAYPRSLHGKPLHGLRE
NQLNCDGALEPHTFSLLPSQRQVVFRGDRLPFHCTAALVDKITTLHWRHNGQLVTSDPEM
GVQLEESAVHDCTFITSELILFNVHVEASGEWECVVTTGRGNISRTVEIVVLENSASFCP
EEKVKNDRGEFRWPRTLAGIMSHQYCLQQRNPSLPLEGDREQKKALRYCDRDGNWQEGDY
TNCLYTNHITRVLHTVILTPINTSNAMTVAHQVRSYTLEAAGFTDPVAVLHVAQMMEKFM
EYVTQLRELSEVLVEMGSNLMQVDDKILVNAQREKRACSSLVNSLETLAWPQLHSHAQDL
SMVSRNIVMEAHLIRPEYFTGITCTAYQRRETPGSSVGSDGLEYNHDQDLSFRCSTGSHN
TSLTNFPLKNSIALASVTLPASLFPPDAPKDCKLQFVAFRTGCFFPLLGNSSGIGEHFRR
RTVNTPVIFAGLEGCSMWNHSEPIWVSLRHLSPGTDPEAAQWSLPGLEKQGGWSQDGCQL
VHTDSSTSTLRCTVLSNYAVLQEVPDFPNPSAISVRILHPVVYACTAVLLLCLFTIIITH
ILHHSSIYISRKSWHTLLNTCFHMAMTTAIYAGGISLTSYPVVCQAVGIALHYSSLSTLL
WIGVSARVLYKEAVWRTPRQPEGEPSVPPTQRPMLRFYLIAGGVPLIICGITAAVNVNNY
GDNSPYCWLVWRPSLGAFFVPAGLVVLVTWIYFLCTVFRLRHRVAKECTGTPLSSPVAES
LPALSGSTSLLSTDSAAAPTTPVAAPEDQYSLKAQFSVLVVTHFLFMALWCCGAMAMWLS
GHSSLLFSCLYGIAATTLGAFLVVHHCFRRLDVQASWLACCPGYRQPQVPSTYTQACTAV
NGVQTSDQGSQLFIGCHPPGDSQNSSSARSSSTPSGISSVGPGPCKLTNLLQVAQEHPNH
APRAPAGAHHGIHPGASTDNVTKPSNNHLPIIASMAPVHPQRRKVSSRTKQGSSHYHHRG
EGRGHYRLKALRAGGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPLPPAGSRAAPQGAQRRCASRDNLKLERETKRCSYPLNSVCVAVPGPAPA
PNGTLKNSGVPEHQEKDTSGTDQSQSSVGMKSGLWKSETTV
Download sequence
Identical sequences ENSGMOP00000006502 ENSGMOP00000006502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]