SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006590 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006590
Domain Number 1 Region: 1-179
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.62e-22
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006590
Domain Number - Region: 89-94
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00212
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006590   Gene: ENSGMOG00000006174   Transcript: ENSGMOT00000006783
Sequence length 199
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_140:38479:42941:-1 gene:ENSGMOG00000006174 transcript:ENSGMOT00000006783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFENKDKIVIVMEYASKGELYDYISERRRLGDRETRHFFRQIVSAVHHCHKSVLLHLFPL
LALLGAVPGPTSLFSLSFLLPFLHLLLHPPPPPPSPPLPHPPPPTPPVDSWALGVLLYTL
VYGTMPFDGGDHIKLIKQISNGDYKEPSQSSDARGLIRWMLMVNPRRATVEDIANHWWVN
WGWKSSVCDCQGPPSQGSP
Download sequence
Identical sequences ENSGMOP00000006590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]