SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000006894 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000006894
Domain Number 1 Region: 653-786
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.0000115
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.017
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000006894
Domain Number - Region: 392-397
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0112
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000006894   Gene: ENSGMOG00000006467   Transcript: ENSGMOT00000007094
Sequence length 808
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1487:5249:31777:-1 gene:ENSGMOG00000006467 transcript:ENSGMOT00000007094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FVCSSGLKKRTRKAFGMRKKEKDNDSTGSPEREGGVSITQCLVPVYFASSVILSQKKSNG
SANGFSGEIDWERYNSPEVDEEGYSLRPDEEEEAKVKTHFFSSDESEEDEDHRKKFKIKI
KPLPSDCPVAMPSVDQLKASICNIALSPSPLXXSQRRSPGVLQRNTSGEEIPRPRRAVPT
VPAVAPTPAPVPQPPLFGPPLDSAFGEQKTEVVLFESDMWGAPLSEPLTRPFPTGTPPPL
PPKNVPTSPPTTGPPSPFGTVAEVPSEAEDSIAKPSFADLDNIFGPEEGSSAIGDDTGDQ
WVCFSDKSPARPALPQEPTPPPPSSPPPFPAPTPPASPPLPEDPVSAPQTSPPPGHQQPQ
SPDSPRAGGDKEGPISPKDRGGASQGSRSTPPPPPPPTYRAVVSSPGPTSGATGTASGSS
SPVRPSTPSSVSPSPPPPPPRPPSRPKLPPGKPTAAGDVGRLSSAPVHSASPPPIAPLAR
AESTSSISSNNSLSTATTPTVGENDQPSLVWFDRGKFYLTFEGCSRGPSPLTMGAQDTLP
VAAAFTETVNAFFKGADTNKCVVKIIGEMVLSFPAGITRHFANNPCPAVLTFSITNYSRL
EHVLPNPQLLCCDTTTQAKGDAKDFWVNMPNLISHLKKVSEQKPQATYYNVDMLKYQVST
QSHQSTPLNLAVSWRCEAASTDLRIDYKFNGDAMSTPMALNNVQFLTPVDGGVSKLQAVL
PPAQWNAEHQRILWKIPDISQKSDNGGVGSLLARFRLSEGPSKPAPLAVQFTSEGSTLSG
CDIELAGPGYRFSLVKKRFAAGKYLADN
Download sequence
Identical sequences ENSGMOP00000006894 ENSGMOP00000006894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]