SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007352 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007352
Domain Number 1 Region: 740-891
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.23e-35
Family DBL homology domain (DH-domain) 0.000000965
Further Details:      
 
Domain Number 2 Region: 892-1025
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-29
Family Pleckstrin-homology domain (PH domain) 0.0000376
Further Details:      
 
Domain Number 3 Region: 283-352
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.71e-21
Family Regulator of G-protein signaling, RGS 0.00041
Further Details:      
 
Domain Number 4 Region: 4-81
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-20
Family PDZ domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007352   Gene: ENSGMOG00000006673   Transcript: ENSGMOT00000007561
Sequence length 1028
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4368:193574:208029:1 gene:ENSGMOG00000006673 transcript:ENSGMOT00000007561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQRCVIIQRDENGFGLTVSGDNPVFVQMVKEDGAAMRAGVQTGDRIIKVNGTLVTQSNH
IEVVKLIKSGSYVALTLLGQPPGLSEALQEEEEQAEEEGVVEKEEEGELQKSEGREGDGP
LSTPLVQPPMLEQGGPLTDDIMNSSPRQQQHIDGPPTPLRSSVFQPLSSHVTAVQLVHRF
HLASPLNEDGDAVLSEWQMKRSSPLNDKLWSSAGGQFVYPSQSDTPCHNPKTNLDDSPHF
SPSPDRDDPYPLCIMGTPPSPAHPPIIGAEDDYFDTQQEQINGQCSCFQSMESLKSRPAH
LAAFLHHVVSQFDPAPLLCYLYADLHHQTRSKESRRIFMDLHSLFLDPTAVSHPLCLSLS
LSLLKGSFSKIHVYHQRCTILQSKSSKSEKEGEEKVKRPRFPNILGQPRRPSRVDSTYGE
FKNSSHQESLCVVSSTEVTLFLIHTSCRTMLFPACVLSSKPTIGISQSNPRLMAMLFELG
LTKVHILSHTKNSEKRQEVRRLYFPFFFFGRIKCVKPISMLVSKAMELNKQRSPKPLPQP
PLSSIIPEHPDPPIPSSSRIRGNQHGDGPDAGPQLFPGAVPPPLLHSVSSNQSSESCGQE
SDSGSYTTIVSFTAILFGRFHTDTPTPFSPLPWSSAGLSPLSWASLQSDSACHSGDLQEC
LPSPASAMHFDFSPATLEQLPLEENEATLDLFDLSHFSYLSDPSTGLDNKSLRKLWMMKR
MTLNVTSMLSDSTSARKVSITEQMATIQRRSETSVIGHIGDDLLAWFGGEQEEKVRQAVG
TFCSNQPLALEIIKTRQKKEQRFNAFIQEAQSNRLCRRLQLKDIIPIEMQRLTKYPLLLE
RLAKYTEDCEEREKVRKAGKCCRDILSHVNQAVKEAEDKQRLEDYQRRLDLSSLKQSENP
MVLEFKNLDLTKGKMVYEGPLSWKVNKDKSIELFSILLEEVLVLLQKQDERLVLKGQSMN
LAGTFSPIIKLDNVLVRPVATVCPPADAKSFFVISTSGNRAIYELAAHTVSEQKTWQRLI
TQCAETMK
Download sequence
Identical sequences ENSGMOP00000007352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]