SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007608 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007608
Domain Number 1 Region: 21-344
Classification Level Classification E-value
Superfamily Cysteine proteinases 6.13e-101
Family Calpain large subunit, catalytic domain (domain II) 0.000000185
Further Details:      
 
Domain Number 2 Region: 432-472
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.00000000759
Family Calpain large subunit, middle domain (domain III) 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000007608
Domain Number - Region: 352-374
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 0.0876
Family Calpain large subunit, middle domain (domain III) 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007608   Gene: ENSGMOG00000007148   Transcript: ENSGMOT00000007826
Sequence length 474
Comment pep:novel genescaffold:gadMor1:GeneScaffold_4258:395637:401920:1 gene:ENSGMOG00000007148 transcript:ENSGMOT00000007826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEECTGIINLRYAEGSVGTSSNPDLYNRQNYEQLKQTSLRRGYLFVDTTFPPDRNSLGE
VPGMPQWQQQQVKWMRPVLQKSRGEVAFLMDGASRKDFGQGAIANCWFLAAIGSLTLHKG
LLVQVVPSDQSFKEYAGIFHFRFWRFGRWVDVVIDDFLPTYQNRLISVNSKTGHEYWVPL
LEKAYAKLCGSYADMHAGNPAEAFKDFCGGVFKHFQLRNEHSQNHDEELWGCLSRATDCK
SMIGCGTFAAGRTGLVDWHAYAVTGVTEVTHRGSSVRLVRLLNPWGRQEWTGEWSDSSDL
WNQVSSEDKKKCVKSEDGEFWMELEDFCHHFNYMSICCENPNFIDGDLSCQWKCMSYNGS
WIAGRTSGGSIGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTKDREVMQLIKVDPGEYLVVPCTMYANVSDEFLLTVYTKAGV
Download sequence
Identical sequences ENSGMOP00000007608 ENSGMOP00000007608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]