SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007636 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007636
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily WWE domain 9.16e-26
Family WWE domain 0.001
Further Details:      
 
Domain Number 2 Region: 88-166
Classification Level Classification E-value
Superfamily WWE domain 4.58e-20
Family WWE domain 0.001
Further Details:      
 
Domain Number 3 Region: 372-475
Classification Level Classification E-value
Superfamily RING/U-box 9.19e-16
Family RING finger domain, C3HC4 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007636   Gene: ENSGMOG00000007168   Transcript: ENSGMOT00000007856
Sequence length 496
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_3384:3638:12900:1 gene:ENSGMOG00000007168 transcript:ENSGMOT00000007856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLAPAVVVWEWLNEHGRWRPYGPAVSHHIEAAIRNSDPRGGSVVLGQVDSRLSPYIIDL
QSMHQFRQDTGTIRPVRRCFYEPGTAPAQGVQWEWESSTGAWTTYDMEASIAIHKAHSRQ
QAGLDLEPLGLAQLIDFSTMTQVNRQSGRCRRLRRRVDMAYPLVSGPLPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXPVPSPSPVVMKQAMSLVPLPRRSSLAGLSRPALQRIARAQNSTLLAAGXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXRSPEEVVRRYVLKVKTPQDQDCPICMDPLAGPAGYVGPQTGSSARADTVVR
LAECGHVQHLGCLLAHYDASCRDGSLQCAICKTVYGVRTGNQPAGKMQFHVIPPSLPGYP
DCKTIRIVYNIPAGTQ
Download sequence
Identical sequences ENSGMOP00000007636 ENSGMOP00000007636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]