SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007695 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007695
Domain Number 1 Region: 13-252
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.98e-58
Family Eukaryotic proteases 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007695   Gene: ENSGMOG00000007191   Transcript: ENSGMOT00000007916
Sequence length 254
Comment pep:novel genescaffold:gadMor1:GeneScaffold_1983:33857:38449:-1 gene:ENSGMOG00000007191 transcript:ENSGMOT00000007916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTLITMALHNTWVVLMLVLSLRGQVQTGKIIGGRPAVPHSRPYMVLLERRMWNDETKFCG
GFLISDQFVVTAAHCQARIYNIYGGLHKFKNYQTTKAIQVKREIPHEDYNNKTKINDLML
LQLSERVNFTEHVRPIHLAHRGDHLPQRCIVSGWGYSEENPNDMASELREVNVTLVKRKQ
MARRLREVEVTLVNRTHPAELHAYFSLGDSGGPLVCEGEVAYGVVSVSTKCLKVYTKIPD
YLGWIEGHMRKNNP
Download sequence
Identical sequences ENSGMOP00000007695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]