SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007768 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007768
Domain Number 1 Region: 53-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000416
Family Ovomucoid domain III-like 0.008
Further Details:      
 
Domain Number 2 Region: 143-219
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000519
Family Calbindin D9K 0.062
Further Details:      
 
Domain Number 3 Region: 225-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000387
Family VWC domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007768   Gene: ENSGMOG00000007270   Transcript: ENSGMOT00000007990
Sequence length 310
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_868:16939:42414:-1 gene:ENSGMOG00000007270 transcript:ENSGMOT00000007990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRSAAALVLLSLALSTAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSCKPHKR
SVCGSNAKTYRNHCELHRDACLTGLKIQVDHDGHCQXXXXXXXXXXXXVCYVADRNELRS
RVIQWLQTEVVPDGWFNKGSNFSDILLRYFKTYDNGDTQLDSSELLKFIQHNDSNVDLQS
YADQESNRLLRSLCVDALIELSDDNADWKLSFDEFLNCLKPGFNPPEKKCALEDETYEDG
AETQVECNRCVCACGNWVCTAMTCADKTALVDESADAGAEVTEEEWNRRVAELNKHQETV
EKMKASTKEV
Download sequence
Identical sequences ENSGMOP00000007768 ENSGMOP00000007768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]