SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000007861 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000007861
Domain Number 1 Region: 1583-1986
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 9.81e-100
Family Hect, E3 ligase catalytic domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 434-732,822-935
Classification Level Classification E-value
Superfamily ARM repeat 7.3e-37
Family Armadillo repeat 0.0017
Further Details:      
 
Domain Number 3 Region: 731-796
Classification Level Classification E-value
Superfamily WWE domain 0.000000034
Family WWE domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000007861   Gene: ENSGMOG00000007345   Transcript: ENSGMOT00000008090
Sequence length 1993
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1510:216053:240502:-1 gene:ENSGMOG00000007345 transcript:ENSGMOT00000008090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNRPNSNPGGSLRRSQRNTAAAQPLDHTVAGRSGLSLSVASFVLPDDPEAAGTSQQERP
GHQSKSESTRGLKRNSAPDHVSTYVPTPAKKSKTLPPRRDNTLETKKSSAKSKKRPLAPE
PPAPSGRGQGKKSGAAGASPTLKRKKADPLPGLSSTTGSLPNSIEGRTAKPSKLASKSAA
SAKAGCSAVTDSSSSASTSSSSSSAGTNSAAPQGARVKQGKDQNKARRSRSASSPSPRRS
TRDKEQAKAAGSSKFEWAARFNPKVNLPKPKLSLPGSSKTETSKPGPSGLQAKLASLRKS
TKKRSESPPAELPSFRRSTRQKTTGSCASTSRRGSGLGKRGAADARRQEKMADSDNNQDG
ANSSAARTDEAPQGASGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLGPRMSQ
LFHRTIGSGASSKAQQLLQGLQATGDESQQLQAAIEMCQLLVMGNEETLGGFPVKSVVPA
LIALLQMEHNFDIMNHASRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQFIDVAEQALT
ALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFNFVADSL
PLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASPDLLTNIQQLLVVTPPVLS
SGMFIMVVRMFSLMCSNCPCLAVQLMKQNIAETLRFLLCGASNGSCQEQIDLVPRSPQEL
YELTSLICELMPCLPREGIFAVDVMLKKGSAQATEGAIWQWRDDRGLWHPYNRIDSRIIE
QINEDTGTARGIQRKPNPLANPNTGSHQEVRREDARAQLMKDDPELAKCFIKTLFGVLYE
VYSSSAGPAVRHKCLRAILRIIFFADADLLKDVLRNHSVSSHIASMLSSLDLKIVVGSLQ
MAEILMQKLPDVFSVYFRREGVMHQVKNLAESESFLVTSPPKACTSGTTSLCTTTISTAS
TTAATNVTPDLGSPSFQHSMDDSLDLSPQGRLSDVLKRKRLPKRGPRRPKYSPPRDEDKV
DNQAKSPTTTQSPKSSFLASLNPKTWGKLGTQTNSANSEPSRTAGVSGLARAPPKDSISN
NRDKIKAWIKETACKFVERYFNSENVDCSNPALNVLQRLCAATEQLNMQVDGGVECLLEI
SGIVSESDVSSFEIQHSGLVKQLLLYLTSNTDRDVVGRDLVGRDVRLKRFLNVFYGCPLP
GMETAGRLDPSENGPLLALVHKMNNCLSQMEQFPVKVHDFPSGNGSGSSMFFHRGSQALK
FFNTHQLKCQLQRHPDCTNVKQWKGGPVKIDPLALVQAIERYLVVRGYGRIREEDEDSDD
DGSDDEIDESLAAQFLNSGSVRHRLQFYIGDHLLPYNMTVYQAVRQFSLQAEEERESTDD
EANPLGRAGIWTKTHTIWYKPVREDEDGTKDAVGGKRGRAQTAPTKTSPRNAKKQDELWH
DGVCPSVANPLETYLISEPPENITFEDPSLEVNLLLRVLHAISRYWYYLYENAVCKEIIP
TSEFINSKLTAKANRQLQDPLVIMTGNIPTWLIELGKTCPFFFPFDTRQMLFYVTAFDRD
RAMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTINREELLKQAESVMQDLGSSRAMLEIQ
YENEVGTGLGPTLEFYALVSQELQRADLGLWRGDEVTLANPKGSQESTKYMFSSRGLFAV
PFGRTTKPAHIAKIKMKFRFLGKLMAKAIMDFRLLDLPLGLPYYKWMLRHETSISSHDLV
NIDPAVAKSIQHLEDIIRQKKRLEQDRSQTRETLQQGLESLNMNGCSVEDLGLDFTLPGY
PNIELKKGGKDIPVTIYNLEEYLRLVVYWTLNEGVSRQFESFREGFESVFPLHHLQYFYP
EELDQLLCGSKSETWDVKTLMECCRPDHGYTHDSRAVRFLFEVLSSKDAEQQRLFLQFVT
GSPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLL
IAAREGQQSFHLS
Download sequence
Identical sequences ENSGMOP00000007861 ENSGMOP00000007861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]