SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008471 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008471
Domain Number 1 Region: 540-828
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00000497
Family HBL-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008471   Gene: ENSGMOG00000007910   Transcript: ENSGMOT00000008709
Sequence length 1217
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2326:161150:179044:1 gene:ENSGMOG00000007910 transcript:ENSGMOT00000008709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGGPTPLDHGVQIRFIKDLQDARGGGVPGPQPRTKPRPASKYGVAVRVQGIAGLPYVVL
KDGGEKGDSYGVQLKTHYPPGYGSLPRRREKAEVGEQGGEVMYGGGGGGGGEGGGALRRA
QSHGSLLDRDGEEPGGGEEFQLRRPPGDGRSGSYGNLDGGLVVGREREGARGGAVERRTR
AGVIRTALDGTGGSVRPNPPPPAPPPQTTELHSGQRRITPVNRLINRFDGRRRRCQQRVY
SPRPEDPREASPVLTPNPYSSRPSSTDSSLGRNQSSLQWAQWSPTGRAVAVTTTTAHPLR
EKLCLKVTPDLLLDQGQVVNEEEEQLMQTLYSILRDGTSESEVAIRQKVQVIFQKVQSLR
SRDGSGAEWRKEKRELERSLGDLQAALKEERRLFIVCACAQGSSGRPDPALREQLESSLD
ENIQLQEMLGRKNKEFHQTQSELIQLRMERENAETRVRDVEDQLAGLQDELRETHRHGTX
XXXXELAGFQAQLAEASQLKQRLEEGLRQRERELTALKGVLKDEVASHDRDMESLREQYS
TDMEKLRGSMEQVSQSQAGIEAERLRVNSSVRSLQQQLEDCRDESSHWMEQFHTTKDELR
TTRQELLKVRLDKEEFEEELKELQGRVSSMKQQIPDPSHAESLSKELSSSRSNLLKVQSE
VEKHRTDMDRKVMEVISLKKAHQEQEAELKYEIDRLKEQLKKAKEEFAKEQQRSKKLPDP
SVVSEMEQKLGEAKGEGTRLQEKLSLVEAELQSTKTCLCRARTEPISETQKEQEEASKRI
RDKFVRLEAQLQSSTSESSELEVALHSEIRGLKSELDEAKRTASRLGQETIELRQSLEVR
EREKEALAQSHSQLEEARLQQEKALEKLLREHESVQGSSREEVQILRAQLEEQREKTRKE
TQEAHRHGNDAQADLERSQASLRRLEEEMSRQKKELLLACEERDNHQLDRELLTNRLRHL
EGELENSKNSHSEKSRENRLLEDKMKRLEMELEEEKGNAEMLMDRVNRSRDQIDALRSEL
LQERSSKQDLELDKTTMERHLKELKSRLADMEGQSRSSAGVSQLELQVQELEERLRSEDR
EKNSMVASQRRLERKLKELSMAQDEERQQHTDQRDQLTLRVKALKRQVDEGETEVERVDG
LRRKAQREMEEQLEQKDALQTRIKALETELKRKTQAVRRQALDSSALSSEDDDDDRLYDP
SGITSYLTESNLQTSSC
Download sequence
Identical sequences ENSGMOP00000008471 ENSGMOP00000008471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]