SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000008916 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000008916
Domain Number 1 Region: 3953-4309
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 6.15e-129
Family Hect, E3 ligase catalytic domain 0.0000000354
Further Details:      
 
Domain Number 2 Region: 1618-1684
Classification Level Classification E-value
Superfamily WWE domain 1.44e-17
Family WWE domain 0.002
Further Details:      
 
Domain Number 3 Region: 1304-1359
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000383
Family UBA domain 0.0067
Further Details:      
 
Domain Number 4 Region: 281-422,520-641
Classification Level Classification E-value
Superfamily ARM repeat 0.000000523
Family Plakophilin 1 helical region 0.099
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000008916
Domain Number - Region: 84-169,234-337
Classification Level Classification E-value
Superfamily ARM repeat 0.0144
Family Armadillo repeat 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000008916   Gene: ENSGMOG00000008327   Transcript: ENSGMOT00000009162
Sequence length 4316
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2603:751337:786559:1 gene:ENSGMOG00000008327 transcript:ENSGMOT00000009162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRSKLKKTPTEAPADCRTLIEKLKACSDEQLLVELQHIKTWNIGKCELYHWVDLLDR
FDGILCDAGQTVESMSWLLVCDRPDNGHLKALLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRTPLLARLQHLAESWGGKENGFGLA
ECCRDLPMSKYPPSATTLHFEFYAEPGPEVKVERKTSSNTLHYIHIEQLDKISESPSEIM
ESLTVMYNIPKDKQTLLFTHIRLAHGFSNHKKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERTPKLSNIIDCTGTASYHGFLP
VLVRNCIQAMIDPLMEPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHTGLTIFISRLEHEVDLSRKECPFVIKPKIQ
RPSTATESEDMDTDMDSMQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHVVMDGSLPTS
LKHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATRE
VLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNL
GSAVDELMRHQPTLKTDATTAIIKLLEEICNLGRAPEYICQKPSIQKADGTVAVPPARSS
HAAEEASSEDEEEEEALHTFSQQQGEPESNRQVVGTEERIPIPLMDYILNVMKFVESILS
NNTTDDHCQEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQ
EGLCQLDSILTALEPLHRPIEVPGGSVLLRELANAGHVADATLSARATPLLHALTAAHAY
ILMFVHTCRVGQSEIRAISVNQWGSQLGLSVLNKLSQLYCSLVWESTVLLSLCTPNSLPP
GCEFGQADMQKLVPKEEKPSGSATATPASGSRRTESEAVAVDSSAGGLLEGMGLDGDTLA
PMETDEPTATDPKAKSKLTPAMATRIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHATSTGTAPTPAARATASSLTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFFCSGGHDALFETFNWALSMGGKVPVSEGLEHTDLPDGTGEFLD
AWLMLVEKMVNPSTVLDSPHSLPAKVPGVTPTTPQFSALRFLIVTQKAAFSCIRSLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIQERLGKEREGTARPEEEGDSTNSTPRREPQVNQ
AQLTQLMDMGFSREHAMEALLNTTTMEQATEYLLTHPPPLLSGAVRDLTMSEEDQMMRAI
AMSLGQEVSMEQRSDSPEEAARRREEDDRRARERAEEEEARCLERFMEAEPLDPQELHAF
TDSMLPGCFHLLDELPDTVYRLCDLLMTAIKRSGPEYRDLILGQVVHQVWDAARVLIKAA
EPLTTSDTKTVAEWTRQMATLPQASKLATRILLLTLLFEELKLLCTRVVERSGILDLLIK
LLEVVQPCLQAAKEQKDIQTPKWITPVLLLIDFYEKMAVSSKRRAQMNKYLQPNGNNWRW
FDDRSGRWCSYSASNNSTIDSAWRAGESSVRFTAGRRRYTVQFNTMVQVNEETGNRRPVM
LTVQRVPRLPKPSKTGGAADSEREEGEKTKPEETQTDLEPGAAVEMAAPKEDTSPPKDAT
STGPSAPPPDPDPAQGTDIAVEGLSEDMTTVLIRACVSMISVPVDPDTLHATLRLCLRLT
RTHHYAMMFAELKSTRMILGLTQVSGFNGFTPLVTLLFRHIIEDPATLRHTMEKVVRSAV
TSGAGSTTSGVVSGSLGSREINYILRVLGPASCRNPECFAETANSCIRIALPAPRGAGTV
SDDEFENLRIKGPNAVQLVKTTPLKLSPLPTIPETIREVICDMLNALAAYHAPEEHGPAE
RPEELPGGQDLSQILQDVGDDVYQQYRLTRQGSDFDSQSAFHINPQVFAADGAVADSSQS
GTPQGEASTPEELREEKKEQEGEKGAGTEESKAAKAKASKPLMPTSTILRLLAELVRSYV
GIATLIASYSYTAGQSELIKEDCSVLAFVLDHLLPHTQNSEDKDTPALARLFLASLAAAG
TGTDAQVALVNEVKAALSRALAMAEGAEKHARLQAVMCIISTIMESCPSTSSFYSTATAK
TQHNGMNNIIRLFLKKGLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSL
FGGKGGSSKNKAEHDTVGAARDSNSNTTDQGEPGEAEPVEGSRVPGADSDLMDGETEADT
VVIAGQPEVLSTQAMQVENELVDLIDELLERDAVTVNSTIIVGRSGEDESQEDVLMDEAP
SNISQTSTLQANREDSMNILEPEDEEHTQEEDSSGSNDDEDSKECMLIFPQDDEEGDEDD
DDEGSEMELDEDFPDINAAPHIRFERFDRDDDLIIEFDNMFSTTADIPPSPGNIPSSHPL
MVRHADHGSLTLGAAGTSSRLAQGMGRSQRTLRQLTANAGHTIHVHYPGNRQPNPPLILQ
RLLGPSAAADILQLSSSLPLQSRGRARLLVGNEDVHIIARSDDELLDDFFHEQSSTGGQA
GTLSSIPTALTRWTDECKVLDAESMHDCVAVVKVPILQHLESLRDEELEERREKRRRQLA
EEEEAKQSERRASGAEDSREQSLQAVPEAPPSGEVTPTTPAPHEQALVSLETAISQQVHQ
PIADLLLAESHASSLAALAVAEASQMEMSPAPTIASLSPDIAEPVAVGVSQLEGSPMDTS
SPASTTLEEAAPNPAQTAHLSQELSGSAGSADSGLTDRQTDAETGRSTTVSSPGETMPRS
DSADSQSQAIQEEPLPSTSNDDEDPLAGINLPEGVDPSFLAALPEDIRREVLQNQLGIRP
PSRPPVTSSLPSSTTPVLSGPGVTEVSPEFLAALPPAIQEEVLAQQRAEQQRRELSQQPT
QGDTPLDPVTFIQTLPSELRRSVLEDMEDSVLAVMPPDIAAEAAALRREQEARQRQLMHE
RLFGHSSSSALSAILRSPAFTSRLGSNRGVQYTRLAVQRGGTFQMGGTNHNRPSSSTVDS
LLRLRGRLLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHSQTRGWVIRSLLSILQ
RSSESEVCVETTRLDDARGKRNPQSSSSSSSSSSASSSSSLELLNRVESRSSSQLSWLSV
SMDAALGCRTNIFQIQRASGRKHADRHSAGGTGVHIHPQAAPVVCRHVLDTLIQPRFSPA
TTQQRCKDLSTSPSDLDARLCLATAGAAGSLGISTDFWDLLVKLDNMNVSRKGKASMKTV
PLGGGPEAEGAQFSLEASPLGQLMNMLSHPVIRRSSLLGEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTAGSAQVAATGLVGAVVQGSSSLASLAASHM
AASAASSLPTSTVNISTTGKQRIAVCSNEIDSKLASTGLTEKQLQLSVEVLTSHSCSEEG
LEDAANILLQLSRGDGTTRDTVLRLLLSGARHLGYTLCKQIGTLLAELREYNLEQQRRAR
ADALSPDAPPEDSSMTRLKGKVPSRFDGSESVVIVAAQKRTLGGRELQLPCMSSLTSKTS
TQKFFLRVLQVIIQLREDTRRANKKAKQTGRLGSTSLGSASSIQAAVRQLEAEADAIIQM
VREGQRARRLQHGPPSEGQSVSEAQAAQRDESPMDVDQPSPLDQDAVPLDDEGNSQSESE
ERLPDLPLLSEQLLLDELWDMLGECLKELEESHDQHAVLVLQPAVEAFFLVHATERESKP
PVRDTRESQLSHIKDEPPPLSPAPLTPATPSSLDPFFSREPSSMHISSNLPPDTQKFLRF
AETHRTVLNQILRQSTTHLADGPFAVLVDYIRILDFDVKRKYFRQELERLDEGLRKEDMA
VHVRRDHVFEDSYRELHRKSPEDMKNRLYIVFEGEEGQDAGGLLREWYMIISREMFNPMY
ALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRVVAKAVYDNRLLECYFTRSFYKHILG
KSVRYTDMESEDYPFFQGLVYLLENDVSTLGYELTFSTEVQEFGVCEVRDLKPNGANILV
TEENKKEYVHLVCQMKMTGAIRKQLAAFLEGFYEIIPKRLISIFTEQELELLISGLPTID
IDDLKANTEYHKYQSSSIQIQWFWRALRSFDQADRAKFLQFVTGTSKVPLQGFTALEGMN
GIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESYEKLRHMLLLAIQECSEGFGLA
Download sequence
Identical sequences ENSGMOP00000008916 ENSGMOP00000008916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]