SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009122 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009122
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily Macro domain-like 9.08e-31
Family Macro domain 0.00089
Further Details:      
 
Domain Number 2 Region: 342-410
Classification Level Classification E-value
Superfamily Macro domain-like 5.55e-17
Family Macro domain 0.0011
Further Details:      
 
Domain Number 3 Region: 575-723
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.00000000000882
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009122   Gene: ENSGMOG00000008517   Transcript: ENSGMOT00000009370
Sequence length 723
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_591:45265:49715:1 gene:ENSGMOG00000008517 transcript:ENSGMOT00000009370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VWKADLPSFHTAVVNVANENLPHYGGLALALCEAGGPDIQSDSDTYIKRNGALKTGDAVI
GNPRCLPQKIIHAVGPRLSPGPFSYDVQWAEPRLKRTVKSILDRAEENNFKSVAIPALSS
VVFNFPVDKCTDIIVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILYNAIQECLKMANAEKH
KSIAFPAIGTGHLGFTKQEVAHIMTKAVEDSAKKMQTKMEVYFVIYPPENDTFMAFEAKI
RGLQGQSSPGSILGYHWVSKSHIKFTSASMEANEEARSWLEELLRCSGTATVNNNFIQYL
GVEELHQLNSGVTGHEFFEMGCAKIKVQAESPKDVIVHVLKAETMLCDVQKEFARGVKAH
MPAANRKLSDAASIDQGTECINSKNRGYPFRGNFLLKVKILPVVNAALMEVFELKKKQLG
SSSPPRRMYHRIPAQFCSRLQDIGFQREYAPPSAPKYGEGIYFSGSVRGAVDLWREQSHQ
DVYQYYVEAKVLTGKSTPGKRDLIMPPPVGDDPLVRFDSLSGGTDISVIFNGHQALPECI
IIC
Download sequence
Identical sequences ENSGMOP00000009122 ENSGMOP00000009122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]