SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009276 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009276
Domain Number 1 Region: 92-205
Classification Level Classification E-value
Superfamily Macro domain-like 3.87e-38
Family Macro domain 0.0000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009276   Gene: ENSGMOG00000008671   Transcript: ENSGMOT00000009528
Sequence length 276
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4249:3709:122793:-1 gene:ENSGMOG00000008671 transcript:ENSGMOT00000009528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRERGVLLRKVVLGALGFATTAAVCVHTSARVTMAEGTESLKVNLESAEADWKETKDRM
LSLPLDERRRFYRTRCYTSLDQVPVWSPSPGARCPRNKKLDGRISLYTGDITQLEVDAIV
NAANKTLLGGGGVDGAIHRAAGPQLKEECATLLGCETGQAKVTGGYGLPAKYVIHTVGPI
VQRAVGDQERRALRASYRSSLEAAAPPHVAARSLXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXLDRVIFCVFLPADRELYLKNLPLYFPG
Download sequence
Identical sequences ENSGMOP00000009276 ENSGMOP00000009276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]