SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009710 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000009710
Domain Number 1 Region: 178-363
Classification Level Classification E-value
Superfamily ADP-ribosylation 1.25e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 35-121
Classification Level Classification E-value
Superfamily WWE domain 9.68e-20
Family WWE domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009710   Gene: ENSGMOG00000009093   Transcript: ENSGMOT00000009970
Sequence length 371
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4430:602314:612639:1 gene:ENSGMOG00000009093 transcript:ENSGMOT00000009970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GRVFSLDFGALLVCDMEFDRVRRLSTPPSPANTPPSPSPNPVPSCHTVWKYYCRDNFGWR
EYSEPVVRLIEEASGRGLKEVRFITLQNQYILNIKEGFQQNAVFGFRRQIKKRPMYTSSV
MLSPHLQTLGALSSSPHPSSSVAEQLSSPLPLSPTTCNPPTLFPETWLPMATSQDFLQVP
VSREDRSYRTVYSLFHKTVSETKFRILKILRVQNPFLWEKYKRKKEYMSRRLSEMDRMLS
ERHLFHGTSADVVEGICKHNFDPRVCGKHATMFGQGSYFARKAVYSHNFSKRSPKGVHCM
FLAKVLTGRFTVGNPSMRRPPPISPRDASSDLYDSCVDNWVDPQIYVIFNDDQSYPYFII
QYEEVPCTVAV
Download sequence
Identical sequences ENSGMOP00000009710 ENSGMOP00000009710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]