SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000009872 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGMOP00000009872
Domain Number - Region: 70-81
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000009872   Gene: ENSGMOG00000009240   Transcript: ENSGMOT00000010136
Sequence length 204
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_546:61758:62888:-1 gene:ENSGMOG00000009240 transcript:ENSGMOT00000010136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPRSLPSLHQVDPDPKGPAASNNEANRKISALEEELAKLRVQIAQIVLAQERSTQSGICC
SAPTPQAAVPPPPPPPPPPLPPTLQRTFSAMDLIKERRGKKGDGPAAPEPKAAPSMLDVL
KDMGQVKLRSVKSRGGEAKASQPMDAASLIAQALKRKFAHRHRHDSGAEDDGEFTLPIPD
AKPPVQTPSFGQHMLKSSAKRKWD
Download sequence
Identical sequences ENSGMOP00000009872 ENSGMOP00000009872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]