SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010177 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010177
Domain Number 1 Region: 2843-2999
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-35
Family Laminin G-like module 0.00000532
Further Details:      
 
Domain Number 2 Region: 2654-2833
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-34
Family Laminin G-like module 0.00000265
Further Details:      
 
Domain Number 3 Region: 2275-2458
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.48e-30
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 2086-2263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.51e-28
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 2458-2628
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.28e-20
Family Laminin G-like module 0.0084
Further Details:      
 
Domain Number 6 Region: 777-829
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000193
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 7 Region: 827-881
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000558
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 8 Region: 1377-1429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000067
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 9 Region: 251-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 10 Region: 1436-1487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 11 Region: 719-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000262
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 12 Region: 880-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Laminin-type module 0.0083
Further Details:      
 
Domain Number 13 Region: 308-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000145
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 14 Region: 1022-1070
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 976-1019
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.0099
Further Details:      
 
Domain Number 16 Region: 929-978
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00001
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 17 Region: 447-484
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010177
Domain Number - Region: 1485-1523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 61-146
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000258
Family Galactose-binding domain 0.094
Further Details:      
 
Domain Number - Region: 378-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00614
Family Laminin-type module 0.047
Further Details:      
 
Domain Number - Region: 1326-1353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 682-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0142
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 1084-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0195
Family Laminin-type module 0.035
Further Details:      
 
Domain Number - Region: 1934-2079
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0366
Family HBL-like 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010177   Gene: ENSGMOG00000009478   Transcript: ENSGMOT00000010454
Sequence length 3019
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1428:65988:226287:-1 gene:ENSGMOG00000009478 transcript:ENSGMOT00000010454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLFPAVLNLATMADIHANATCGSQGPEMFCKLVEHVPGQPARNRPQCRVCNQKSIKPLEQ
HPIEYAIDGTNRWWQSPSIKNGMEYHHVTVTLDLKQVFQIAYVIIKAANSPRPGNWVLER
SLDGVTYDPWQYYAITDTECLTRFNLNPRTGPPYYTRDDEVICTSFYSKIQPLENGEIHT
SLINGRPSAEDPSPTLLNFTSARFIRLVFQRIRTLNADLMTLALNDPRDVDPIVTRRYYY
SIKDISVGGMCICYGHAKACPLNERTKKFSCECEHNTCGESCDRCCPGYQQQPWMAGTFL
TRHVCEKCNCHGQADDCYFNQTVADLTLSLDATGQRRGGGVCVGCRHNTAGVNCENCSAG
YYRPQGVSLEDPEPCRPCLCHPDGSTSQSCVSDDSQATPXXXXXSCPCKEGFEGLQCDRC
AYGYKGFPSCERCACSIEGSTNNDPCRTPCYCKENVEGENCDRCKLGFYNLRRDNRRGCE
KCSCMGVASQCSASPLAYQNETSLEGWQLIGETGQTVMSVSRTTPPLHSVRHSEVEGNLG
STYYWSAPGVFLGNKLTAYGGNLVYTVSYVTNQQDPNNIRVTSQPDLIIEGAGIKMIDGK
YGQPVYPSSPSTNHVALLPENFLVSESRQPISRREFLSVLADVTSVSVRASYSTEPSAVY
RLHAFSMETSDLHARGEKRASAVEICACPPGYAGSSCEGCVAGFRRVNGALYGGVCEACR
CHGHSVHCHQVTGQCLDCSHRTAGPYCGACLPGYYGNATHGSADDCQPCACPLSLPSNNF
SPTCHLSNAGELLCDRCQTGYTGPRCGRCANGYFGHPSRPGGSCQPCQCHDNLDFALPRS
CDPITGQCLRCRQGYGGETCESCSDGYYGDAVNAKNCQPCQCHTNGSLSEACHQETGQCQ
CREHVLGRQCDECMPQTHGLASGGSCVPCHCNSFGSKSFDCDEAGQCRCQPGVAGPKCDR
CSRGFFLFQEGGCTPCDCSHVGNNCDTNTGQCICPPHTIGERCDRCAPNHWGHDIMEGCK
ECGCSVVGSVAQQCNMNTGCCLCRDAYRGEKCNECQLGYRDFPQCTACECSAAGSESETC
DQERGVCACADRTGKCSCKANVEGHGCEDCKPGTFGLSVRNPLGCSSCYCYGLSQTCSEK
QGLIRMSLMLKPEQTVLPLVDKSNSAETRTGVSFQHPEILVHADLVSSALSEPYYWRLPE
QFKGSMITAYGGQLKYAVYYEAREETGSSSYEPQVIIRGGPNKDLLMMRHTAGLQIGQLT
RHEIEMAEWKHADGRSMTREDFMDVLFYVDYILIKASQGNQMRHISEISLTVAEGGRPNT
ESERAHQIESCECPAGYSGLSCEECAAGFYRLRGGCPASGPASQEPGVAGMGRCVRCQCS
GHSTTCDPETSXXXXNCQDNTEGARCESCAPGYYGVVRGFHDDCKPCACPLTNPENNFSP
SCVSESFDDYRCTDCPEGYEGKYCERCATGYHGNPRMPGGRCEECKCSAWGALPGPCDPE
TGQCRCRGGATGLSCDQCMERHVCGPAGITSCDDDCAGLLISDMDSLYGVITSVNLTTPL
PPPYKILYRFENMTEELKHMLSPQRAPERLLQLADSNLGSVVTEMDQLHNRATKVSADGE
QVEDDAGRIHKGAEDLLRFIHVIQMSPELQAKAAELNATLSRRAGSPEKSLKEMKAEIQA
MLAELRARQLAGKKGMAAEELGLAEELYQKVKRLFGDPHQATEDLKAEVTGKLSDHGGKL
EEAQELLDAAQSKSREAGVLAAQNQANLTALEXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDLEEMERELGPLHDRLETKVAHLTDGLSDGDLADHVGLAEGHAQQLNES
AAILDGILAEAKNLSFNATAAFKAYSNIKNSVDEAEREAKAAKQSAAEALMLASGPDIPI
KDEAKDSLQKSYRLLNQAKQLEDNVKDNAASVANLKGRVKAARDKKDLLKAVNETMATLN
AIPSGEHNILCVPEREREXXXXXXXXXXXLTFCFCLSFLFLISPAIIHAAGAKVKDLEDE
ADRLLEKLQPIKRLQDNLRRNISQIKELINQARKQANSIKVSVSSGGDCLRSYRPDIRKG
RYNTIVLHVKTTTPDNLLFYLGSAKYVDFLALEMRKGKVSFLWDVGSGVGRVEYPHLSIS
DGKWHRIEASRNGLNGTISVYPLEGALAGLLPMPASANSPTAFTILDVDHNAYLFVGGIL
GTVKKADAVRTTTFTGCMGETFLDSKPIGLWNYRDRQGDCKGCTVSPQASEGEGTVQLDG
EGYSGVGRPVRWNPNVSTVTFKFRTFSSDALLMYLATDDMKDFMTLELSEGKIKVTFDLG
SGMATATSASRHNDGRWKSLTMTRNKKKVSTATVSIVDIDSSREEEMASSSPGAATGLNL
KEKQKIYFGGLPTQGNYRSEVTTHRYAGCLRDIEISRTPYNLLGSLDYTGVTKGCSVENI
YTVSFSKPGYMELSGLSLAVATEISLSFSTQTDTGTIFLAVSGADQIDQKXXXGGQRPYL
SVMLNKGSLEVLVFTGSHNTRRVVRRADQGVLHDGREHALRIERLAGRSFAVQVDEEPKR
EAALPNDQPISLRRVFLGGIPAAVELSSNRANVPFQGCIWNLMVNNVXXXXXXXXXXXXX
XXXXXXXXXXXDSCGPGAAPAALEKAYQFGLTKNSHMTFAFDDTKVRERLIMEFELRTTE
DSGLVLYMARINHADFVTIQIKEGQVCLGYDLGHGNTSGCIPFSVNDGNWHKIRLNRNKQ
RAVLMVDGRYSKQMISPKKADLLDVVGLLYVGGLPQNYTSKRIGPILYSINGCIRNFKMV
GGPLDMASPNSTHMVGRCFVATETGTYFDGTGYLKAVSTYRVGLDVSVALEFRTSRTNGV
LLAISNQGNDGLGLEISQGKVLFHVDNGAGRITAEHADPGGAGLCDGQWHAVVAHKLRHR
LELEVDGWKSQAESPHTRSNTCDTNDPVYVGGYPSGVRQAALSTSTSFRGCMRNLRITKA
SRTMEVHFNKALEIRGVQP
Download sequence
Identical sequences ENSGMOP00000010177 ENSGMOP00000010177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]