SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010215 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010215
Domain Number 1 Region: 216-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 2.55e-44
Family Pentapeptide repeats 0.00022
Further Details:      
 
Domain Number 2 Region: 88-186
Classification Level Classification E-value
Superfamily POZ domain 5.5e-27
Family Tetramerization domain of potassium channels 0.0092
Further Details:      
 
Domain Number 3 Region: 2-82
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000523
Family Doublecortin (DC) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010215   Gene: ENSGMOG00000009557   Transcript: ENSGMOT00000010493
Sequence length 389
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2071:76844:83686:1 gene:ENSGMOG00000009557 transcript:ENSGMOT00000010493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFVNGTSKNGKVVAVYGTLSDLLSAASNKLGIRASSLFNGKGGLIDDISLIRDDD
VLYVSEGDSFVDPQDEVNAVPVKPGAPSDWLTLNIGGRLFTTTRSTLVSKEPESMLAHMF
RDKCVWGNRQDEHGAYLIDRSPEYFEPILNYLRHGQLIINEGVNIRGVLEEARFFGIEQL
GDQLEAALKNTQPPNDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLTQANLCCSNLERADLSGANLDSGNLQGVKMLCSNAEGASLRGCNFEDPSG
LKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDL
QEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences ENSGMOP00000010215 ENSGMOP00000010215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]