SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010458 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010458
Domain Number 1 Region: 418-598
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.37e-45
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.038
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000010458
Domain Number - Region: 330-378
Classification Level Classification E-value
Superfamily WWE domain 0.000271
Family WWE domain 0.0091
Further Details:      
 
Domain Number - Region: 167-189
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.011
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010458   Gene: ENSGMOG00000009778   Transcript: ENSGMOT00000010742
Sequence length 598
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2612:49395:55176:-1 gene:ENSGMOG00000009778 transcript:ENSGMOT00000010742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SKIIYDNLCANQGCLEFLNLKKYFEKVVSQLTSVLLKIVSDNGKFAVPLAKEIKPRTLVV
ARTQLRVCQKAQGECPQCNHLQLCRYFICGYCRFGYFRNKCKHSHDLASQHNLTILIEAG
LQNLTGKELFPLLLQNDAYLLPEICSHYNRGNGQHGICKFPNSCIRLHVCQHFLQGDCKF
GEKCKREHSFNDQVLKIKAGLSDDNISKLYKIYRCKSIINQQPPNLGKLHTQRRTVCQRS
LKSPPPVILLLPPKPARPTVMKSVSTFYANIAALKVSFLTDKCVRVHYQLPYRWQVQDSV
SLSWIDMPNMETMEKAYCDVRRLSTVSSVSKPNYFILTTDWLWYWQDDNGSWEEYGQEMQ
QQNLKYGTQREVRRRPRFVSTQEVQDKLRGISSPSAASSSLGDSVPANWEKTSLPNFGYK
VIPLTSSSTEYQLVESWFKRTMKTSLINKIERIQNPALWKVFQWQKTMMKDKNGGKPVDE
RHLFHGTEESLLDPICEQNFDWRMCGVHGTAYGKGSYFARDASYSDKYSKAHRGLRRVMF
VAHVLVGEFTLGSSSYARPPSKSTGTSLYDSCVDRARDPSIFVVFEKHQIYPEYIIDY
Download sequence
Identical sequences ENSGMOP00000010458 ENSGMOP00000010458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]