SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010611 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010611
Domain Number 1 Region: 544-756
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-52
Family DBL homology domain (DH-domain) 0.00022
Further Details:      
 
Domain Number 2 Region: 230-374
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-44
Family Third domain of FERM 0.00051
Further Details:      
 
Domain Number 3 Region: 892-1035
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-34
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 741-864
Classification Level Classification E-value
Superfamily PH domain-like 9.51e-31
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 
Domain Number 5 Region: 129-229
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-26
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 6 Region: 49-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.92e-17
Family First domain of FERM 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010611   Gene: ENSGMOG00000009900   Transcript: ENSGMOT00000010901
Sequence length 1044
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1032:47102:90760:-1 gene:ENSGMOG00000009900 transcript:ENSGMOT00000010901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGELEGSYRVIQTPGTRLGAPFNAGISTLEAGGSVGPAAGKNYGRGLQMRVVGLDESQEF
YDMETKSLGQTLLSEVFQRGNLIENDYFGLEFQNTQMNWVWLEPIKPIVRQVRRPANTLF
RLSVKFFPPDPGQIQEEYTRYLFSLQMKRDLMEARLLCTENTGALLASHLVQSEIGDYDE
LGDRDYLRLNTLLPYQDKVQDRIMDFHRRHLGQTPAESDFQVLEIARKLEMYGVRFHPAS
DREGTKINLSVAHMGLQVFQGNTRINTFNWSKIRKLSFKRKRFLIKLHPEVHGPHQDTLE
FLMGSRDQCKIFWKNCVEHHSFFRLLDQPLPPTKAILFSRGSSFRYSGRTQKQLVDYVRD
SGTKRTPYQRRNSKIRSSARSLAYDMPKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSPQLSPFSSKDPLCPASPSFQMSTLSLPGHASPPPHGPVPGGPRLDEDEEGRRKR
YPADKAYFIAKEILTTERTYLKDLEVITVWFRSAVIKENAMPEGLMTLLFSNIDPIYEFH
RGFLKELDQRLALWEGRSNAHVKGDYQRIGDVMLKNMTALKEFTGYLQKHDEVLTELEKA
SKRVKKLETVYKEFELQKVCYLPLNTFLLKPIQRLMHFKLILERLSKHYPQDHPDHHDCS
EALKEVAQIAAQLQSSLIRLENFQKLTELQRDLVGVENLTSPGREFIREGCLYKLTKKGL
QQRMFFLFSDMLLYSSKGVTATNQFKVHGQLPLHGMIVDESESEWSVPHCFTIYSAQRTV
VVAASSKMEMSKWIEDLNTAINMSKSSNDKSDIFFDAGMRDRSNRSSDEVSVEQESEDEM
SSSHGSLDKQAHHRANTTLHVCWHRNTSVSMSDHSLAVENQLSGYLLRKFKNSNGWQKLW
VVFTNFCLFFYKTHQDDFPLASLPLLGYTVSTPEEVDGIHKEYVFKLQFKSHVYFFRAES
EYTFERWMEVIRSAAGRMTLLVPR
Download sequence
Identical sequences ENSGMOP00000010611 ENSGMOP00000010611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]