SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000010810 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000010810
Domain Number 1 Region: 9-126
Classification Level Classification E-value
Superfamily Macro domain-like 4.37e-30
Family Macro domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000010810   Gene: ENSGMOG00000010113   Transcript: ENSGMOT00000011108
Sequence length 127
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_748:873248:874503:-1 gene:ENSGMOG00000010113 transcript:ENSGMOT00000011108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSAEERCTVSHVSGDLFSCPEDEALAHCISEDCRMGAGIAVLFKKKFNGVEELKAQITKS
KASQKPTYDSLRRSLVDMKTQCTLNGVTRISMPRIGCGLDRLKWEKVSEMLEQVFKHTDI
CITVYSL
Download sequence
Identical sequences ENSGMOP00000010810 ENSGMOP00000010810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]