SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011032 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011032
Domain Number 1 Region: 19-145
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-30
Family DBL homology domain (DH-domain) 0.00074
Further Details:      
 
Domain Number 2 Region: 149-263
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000059
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011032   Gene: ENSGMOG00000010308   Transcript: ENSGMOT00000011330
Sequence length 264
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1955:29409:33862:-1 gene:ENSGMOG00000010308 transcript:ENSGMOT00000011330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQEVRWTGMPFDPRSLEAGCLQFSERFSSYIPYCWEQENTLEFAKRQIDTNPHFVVYLK
WVETHPQCNRMRLGDMQAKPHQRITKYPLLLKAVLKNTPDPDLQQTIRDMLSSVNGFLET
INDYLRCMDEEHALSISAQRLEGYEVPGINEEIDKHIREFCHFDLTLPMVGVGPTFVRKL
LLEENLKMRGGKDSKEEVVALLFSDVLLISKVQKKVERLKVARPPLALDRTCCVPLKDGF
SFLLVEVSELGCAMNVYIFVTATA
Download sequence
Identical sequences ENSGMOP00000011032 ENSGMOP00000011032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]