SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011341 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011341
Domain Number 1 Region: 628-865
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.99e-85
Family Eukaryotic proteases 0.00000349
Further Details:      
 
Domain Number 2 Region: 258-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-36
Family MAM domain 0.009
Further Details:      
 
Domain Number 3 Region: 446-534
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-21
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 4 Region: 140-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-19
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 5 Region: 543-586
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 106-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000123
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011341
Domain Number - Region: 594-617
Classification Level Classification E-value
Superfamily SRCR-like 0.0209
Family Scavenger receptor cysteine-rich (SRCR) domain 0.056
Further Details:      
 
Domain Number - Region: 4-96
Classification Level Classification E-value
Superfamily SEA domain 0.0353
Family SEA domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011341   Gene: ENSGMOG00000010574   Transcript: ENSGMOT00000011647
Sequence length 867
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4438:38750:54423:1 gene:ENSGMOG00000010574 transcript:ENSGMOT00000011647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITEGVIFTDDLKNSSSLQFKALAFDIQLLXXXXXXXXXXXXXXXXXXXXXXGSVLVTFDL
WFHGPVTAQQVQQELRAGLQSPGPMVIDSSSIQITGXXXXXXXXXXCPPAQRACGDLALC
VPDVLFCDGLQNCPNGFDETACDGQFLLTGPTGSFHAESYDSNTQCRWVIRVEKGLSVEI
SFQGFETEEETDALSLYEGVGTEKRLVSVLSGSAPPRKVWLLQDQSTVLFTSDEYNNLPG
FRATYKAAKTSDLSDEQKLTCSFEQGMCFWRQNPAEGNTWIRTSGQTFPPLTGPSSDHTL
GNYSGYYLVTPRSPSQLESSYYIYSLPLTPPPQPICLKFWYHMLGEHVYRLRVLLSELPS
SKPNIMASSTIVFQRDGNYGDNWNLGQVTLNLTMETMVVFEALKRGGMRNDIALDDIILT
SGPCGEAPPEPTNVPPPTTPPVIPADCGGPFDLWEPNSTFSSPNFPHSYGNKANCLWTLH
AREGWNIQLHFLHFDVEATYDVRPRPVSTTNQVTVRFVTNSRGAGGGFQANFTSGLNIGS
PEPCEEGQYQCLLGDCIHGKALCNGVVDCPDASDEADCVVHMPVFNTTRRLQIHTVCSRD
WSQHLSDFTCSYLGHSETCVGEEVISLRCGNQRVVGGVDALKGAWPWIVSLHWRNRHICG
ATLIDPHWLVTAAHCVYGKNIHVNLWSAVLGLHSQGDQSSPDVQPRGVDQIIINNQYNKL
TKQADIAMMHLETPVNLTHVVQPACLPEGEEPPAGRKCFIAGWGYEAEQGSPVNVLQEAQ
VPLMDRKQCQQQLPEYNITSSMLCAGFPEGGVDSCQGDSGGPLICEEDNHWVLTGVTSFG
VGCGRPGRPGVYARVSAFTPWVARTRR
Download sequence
Identical sequences ENSGMOP00000011341 ENSGMOP00000011341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]