SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011498 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011498
Domain Number 1 Region: 292-471
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.89e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.045
Further Details:      
 
Domain Number 2 Region: 171-252
Classification Level Classification E-value
Superfamily WWE domain 0.0000000000000085
Family WWE domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011498   Gene: ENSGMOG00000010741   Transcript: ENSGMOT00000011810
Sequence length 471
Comment pep:known_by_projection scaffold:gadMor1:scaffold00491:54942:61734:1 gene:ENSGMOG00000010741 transcript:ENSGMOT00000011810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSHDLHSEHNARLLRTHGLEDQVKKEICVLLLQNYWLLSVCFDYNNAGCQEGCKRIHTCE
QYMRRNCCCSRAHDFYEPQPFEVLQKSRIPNDLKTEICLLFLEGNCIQPVEKCFGAHYRL
PYSWELLEGHQWTLLDSSEKIEEDYCNPKNTYVCFDTMTCGLQKVRRLSSASSVLQPTSI
LTTEWLWYWEDEHGNWNIRYTGSSTELEQKFQNDPQEVVEFTAGSQTYTLSLQDMIQTNK
KHGTKRVVRRRPRFRSSADVQVIRTRRPPNGPPNVQTFPSHWDKTQVPETGYKKVLLQDS
SEEYKEVETLFRQTMTDFDIVKIERIQNKSLWDHFRLQQEQMKTRNGGCSVAEKKLFHST
DSKYIDDICCSNYDWRICGTHGTAYGKGSYFARDASYSHKCTGNTDVHSTFVSRVLVGHH
TLGSAGYVRPPSKDGGDTLFYDSCADDILSPSIFVVFDQPQIYPEFLLTYK
Download sequence
Identical sequences ENSGMOP00000011498 ENSGMOP00000011498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]