SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011715 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011715
Domain Number 1 Region: 4-98
Classification Level Classification E-value
Superfamily Hormone receptor domain 1.96e-22
Family Hormone receptor domain 0.00032
Further Details:      
 
Weak hits

Sequence:  ENSGMOP00000011715
Domain Number - Region: 115-329
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00011
Family Rhodopsin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011715   Gene: ENSGMOG00000010952   Transcript: ENSGMOT00000012031
Sequence length 408
Comment pep:novel genescaffold:gadMor1:GeneScaffold_2824:2878:23907:1 gene:ENSGMOG00000010952 transcript:ENSGMOT00000012031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEAIHPDCALVVQLVKAKENCIWARRQEARNRTSIRGCQTKWDDIRCWRGAPVGQVVRVS
CANVSQMFANNEGYVYRNCTRKGWSEPYPSYEEACVFAGDPESGSETTTYFSNFRQVYTA
GYATSLVALISAICVFTVCRKFHCTRNYIHINLFSSFILRASAVFIKDGVLFSDENLDHC
FMSTISCKSVVAFFQFSILANYFWLLVEGMYLQTLLALTFVSQTKYFWWYILIGWGFPTT
IIMAWILTRHFYDDNGCWDDTDVVFIWWIIKGPITASLLVNFLIFMNVIRILVQKLKSPG
VGGNDTSNFMRLAKSTLFLIPLLGMHYMVFAFLPENTGAEARIFIELGLGSFQVQAELKK
RLCKWQTQNYLRYSKRRRTLFMESSTITQSSVLDKSSPKDRPASETCT
Download sequence
Identical sequences ENSGMOP00000011715 ENSGMOP00000011715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]