SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011724 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011724
Domain Number 1 Region: 151-372,416-465
Classification Level Classification E-value
Superfamily MFS general substrate transporter 1.57e-51
Family LacY-like proton/sugar symporter 0.057
Further Details:      
 
Domain Number 2 Region: 582-723
Classification Level Classification E-value
Superfamily MFS general substrate transporter 5.62e-19
Family Glycerol-3-phosphate transporter 0.024
Further Details:      
 
Domain Number 3 Region: 489-559
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000000000876
Family Pentapeptide repeats 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011724   Gene: ENSGMOG00000010961   Transcript: ENSGMOT00000012040
Sequence length 733
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1979:336678:360682:1 gene:ENSGMOG00000010961 transcript:ENSGMOT00000012040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDTYDNRTSLAKGAKGIVKEAKRHAAKKVGKVVDRATDEYSSHRNYTRFQDDEEDEGEE
FYRGRPAPDGGGSRDNDEGSSDATEGHDDEDEIYEGEYQGIPSNGKPGGGKVALGQPLSD
AGRDRKELEQERQADEEELAQQYELIIQECGHGRFQWQLFLVLGLALMSDGVEVFVVGFV
LPSAETDMCVPNSSSGWLGSIVYLGMMVGAFFWGGMSDKVGRRQCLLICMSTNGFFAFLS
SFVQGYGVFLLCRVFAGFGIGGAVPIVFSMFAEVLSREKRGEHLSWLCMFWMIGEIYASA
MAWAIIPHYGWSFSMGSAYQFHSWRVFVVVCALPCVCAVVALTFMPESPRFYLEVGKHDE
AWMILKQIHDTNMRARGLPEKVFTVNRIKIPKQLDELVEMESESGNPVSKAFFRIKAEIY
GIYVNLKKCFNYPMRDNMIRLAIVWFTLSFGYYGLSVWFPDVIKHLQADDYASKVKSHSN
ERIEDITFNFTLENQIHTNSVFVNDRFIGMKLRSVTFVDSTFRSCYFDDVTSVGSIFRNC
TIIGSQFFNTDIDDSKLIDGTEVINSTFVHNKTGCQMTFDDDYSAYWVYFINFLGTLAVL
PGNIVSALLMDKIGRLSMLGGSMVLSGISCFFLWFGTSESMMIFMLCLYNGLSISAWNSL
DVVTTESFPTSRRGTGFGFCNALCKLAAVMGNLIFGSLVGITKAIPILMASSVLVGGGLV
ALRLPDTRANVLM
Download sequence
Identical sequences ENSGMOP00000011724 ENSGMOP00000011724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]