SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011769 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011769
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 1.26e-24
Family BTB/POZ domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011769   Gene: ENSGMOG00000011007   Transcript: ENSGMOT00000012086
Sequence length 117
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_2301:132278:132883:-1 gene:ENSGMOG00000011007 transcript:ENSGMOT00000012086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTNYSRQLMQQLWALRTEGKFCDCTILVGDTPHTAHKLVLGATSMLFRSLLEGSDTIS
IDTAVVSSQEFACLLDLAYTGKLPTGKHNVSRVIASADSLQMYDVAVRCKNILSRLV
Download sequence
Identical sequences ENSGMOP00000011769 ENSGMOP00000011769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]