SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011952 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011952
Domain Number 1 Region: 856-1220
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 5.89e-84
Family Formin homology 2 domain (FH2 domain) 0.0000667
Further Details:      
 
Domain Number 2 Region: 203-313
Classification Level Classification E-value
Superfamily ARM repeat 0.00000017
Family Diap1 N-terninal region-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011952   Gene: ENSGMOG00000011142   Transcript: ENSGMOT00000012274
Sequence length 1377
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_1787:35964:101865:-1 gene:ENSGMOG00000011142 transcript:ENSGMOT00000012274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATFVCRVQFLDDTDPFNSTNFPEPTRPPLYTFREDIPLINQLAGVHRLLKAPHKLDDCA
LQLSHNGTYLDLESSLAEQRDELEGFQQDDTGARGKKHSIILRTQLTVRVHACIXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXFRLVVKTALKLLLVFVEYSESNTPLLLQAVTTVCKAWAST
MEILDEKDGVDTELLVYAMTLINKXLAALPDQDSFYDMVDALEEQGMDTVSQRHLGRRGT
DLDLVEQLNIYEVCTDGRRRPAATTGRKDRAGPAEGGDKKCGLERREPQGLAGEAGHASP
LPRLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPHSRPALGGLLSSSYRQHQESLAAERERRRVEREE
RLLRIEREERTRDYVDKMEEARHAREERYKNVERVAAEEYERDRTRVSRARPDLTPDPAC
QSWPSSSRSSPCSEKETVASTGQEEEEILSDKERQNEEVNEKDNCSASSISSASSTLERE
EREERANLSLSGCIEAEVSEPCSKLLNSKLFMLDMLYSQSKKPXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRFGDLVKGLMSPPEADAPSREQGPRPKKESDYIWDQLMAVPRE
LRIKEMDFTDLGEEDDQDILDLDGVMGSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVRPSEYQYQDYSRSGDSLWSKLEPIKVDTAKLEHLFETKSKEIAVTKKTAADG
KRQEVIVLDSKRSNAINIGMTVLPPPRTIKTAIVNFDEYALNKEGIEKILTMIPTEEEKQ
RIQEAQLANPDVPLGSAEQFLLSLSSISELSARLQLWAFKLDYEATEKEVAEPLQDLKEG
MEQLEKNKTLRHILSTLLAIGNFLNGTNAKGFELTYLEKVPEVKDTVHKQSLLHHVCSVV
AENFPQSSDLYSEIGAITRSAKVDFDQLQETLTQMERRCKASWDHLKVIAKHEMKAQLKQ
KMSDFLKDCAERIIILKIVHRRIINRFHAFLLFLGHPAYSVREISVHRFSKILSEFALEY
RTTRDRVLQQKQKRADHRERNKTRGKMIVLSNSSSAPSGHLEREQPQGLGHAEDAAEHES
MKAVLRASLGGGGGGEEKGSEMLAGLRRTRSRPGRGGRIVQAWTQPAPEDSPACGDDAAD
EIMERIVRSATQGPGTRTQPRERRRSRANRKSLRRTLKTGLTPEEALALGLCDSPEL
Download sequence
Identical sequences ENSGMOP00000011952 ENSGMOP00000011952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]