SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGMOP00000011984 from Gadus morhua 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGMOP00000011984
Domain Number 1 Region: 146-360
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-63
Family DBL homology domain (DH-domain) 0.0000000545
Further Details:      
 
Domain Number 2 Region: 345-500
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-45
Family Pleckstrin-homology domain (PH domain) 0.00000146
Further Details:      
 
Domain Number 3 Region: 44-171
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-23
Family SH3-domain 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGMOP00000011984   Gene: ENSGMOG00000011210   Transcript: ENSGMOT00000012308
Sequence length 565
Comment pep:known_by_projection genescaffold:gadMor1:GeneScaffold_4609:30112:50102:1 gene:ENSGMOG00000011210 transcript:ENSGMOT00000012308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAVVVPDGGPEKGSLGEDLGSEEDLLYEDFRGSAHRFGHPGGGGGEQLAINELISDGSVV
FAEALWDHVTMDDQELGFKAGDVIEVVDATNKEWWWGRILDSEGWFPASFVRLRVNQDEH
MEEYLAQFEEAGAGQEDRAGLGLNLGPGLPCKEQMRSNVINEIMSTERDYIKHLKDICEG
YIKQCRKRTDMFTEEQLRTIFGNIEDIYRFQRKFLKGLEKKFNKDQPHLSEIGCCFLEHQ
TDFQIYSEYCNNHPNACLQLSRLMKLNKYVFFFEACRLLQRMIDISLDGFLLTPVQKICK
YPLQLAELLKYTNPQHRDYKDVEAALNAMKNVARLINERKRRLENIDKIAQWQSSIEDWE
GEDVLSKSSDLIYSGEMSKLSQPQAKSQQRMFFLFDHQMVYCKKDLLRRDMLYYKGRVDM
DQMEVTDVEDGREKDFNVSVKNALKLRSLASDSVHLLCAKKPEQKLRWLRAFADERLQVQ
HDRETGFSLTEVQKKQAMLNACKNHPAGKPKGRHVTRPYYDFLLRQKHPSMPSALPQQQV
FMLAEPKRKTSTFWHNIGRLTPFKK
Download sequence
Identical sequences ENSGMOP00000011984 ENSGMOP00000011984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]